Details for Accession #: Q9Y253


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
10001237 VPVTSSEAK T 4 457
10001717 457
10002644 457
10005296 VPVTSSEAK T 4 457
10006119 SFLSSDPSSLPKVPVTSSEAKTQGSGPAVT T 16 457
10011986 SFLSSDPSSLPKVPVTSSEAKTQGSGPAVTA T 457
10016401 VPVTSSEAK T 4 457
10016809 VPVTSSEAK S 5 458
10026661 VPVTSSEAK T 4 457
10036449 VPVTSSEAK T 457
10036890 VPVTSSEAK 457

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
10001237 MS HTP unambiguous human HeLa cells 20 uM GalNAz/200 uM GalNAz None 30059200
10001717 MS HTP unambiguous human HeLa cells Interphase/Mitosis None 0.019515 34161081 The p value was -log10p in original paper.
10002644 MS HTP unambiguous human HeLa cells Mitotic exit/Early mitosis None 34161081 The p value was -log10p in original paper.
10005296 MS HTP unambiguous human HEK 293T cells glucose-deprived/glucose-sufficient None 37541260
10006119 MS, site-directed mutagenesis LTP unambiguous human HEK 293T cells None 29208956
10011986 MS HTP unambiguous human HeLa cells None 30059200
10016401 MS HTP unambiguous human MCF-7 cells None 32574038
10016809 MS HTP unambiguous human MCF-7 cells None 32574038
10026661 MS HTP unambiguous human HeLa cells None 35254053
10036449 MS HTP unambiguous human HEK 293T cells None 30620550
10036890 MS HTP unambiguous human HepG2 cells None 30620550

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10001237 VPVTSSEAK T 4 457 MS HTP unambiguous human HeLa cells 30059200
10001717 457 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10002644 457 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10005296 VPVTSSEAK T 4 457 MS HTP unambiguous human HEK 293T cells 37541260
10006119 SFLSSDPSSLPKVPVTSSEAKTQGSGPAVT T 16 457 MS, site-directed mutagenesis LTP unambiguous human HEK 293T cells 29208956
10011986 SFLSSDPSSLPKVPVTSSEAKTQGSGPAVTA T 457 MS HTP unambiguous human HeLa cells 30059200
10016401 VPVTSSEAK T 4 457 MS HTP unambiguous human MCF-7 cells 32574038
10016809 VPVTSSEAK S 5 458 MS HTP unambiguous human MCF-7 cells 32574038
10026661 VPVTSSEAK T 4 457 MS HTP unambiguous human HeLa cells 35254053
10036449 VPVTSSEAK T 457 MS HTP unambiguous human HEK 293T cells 30620550
10036890 VPVTSSEAK 457 MS HTP unambiguous human HepG2 cells 30620550