Details for Accession #: Q9UHB7


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
10001947 229
10002377 229
10011947 RDPDANWDSPSRVPFSSGQHSTQSFPPSLMS S 229
10014039 VTSKEDKLSSR T 42
10014040 VTSKEDKLSSR S 43
10014041 DLLPSPAGPVPSKDPKTEHGSR S 814
10014042 IESETPVDLASSMPSSR S 586
10015928 ETSGSSK S 5 854
10015929 ETSGSSK T 2 851
10015930 ETSGSSK S 6 855
10024179 ETSGSSK S 854
10024180 ETSGSSK T 851
10024181 ETSGSSK S 855
10037366 TSSSSKEVK 871

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
10001947 MS HTP unambiguous human HeLa cells Interphase/Mitosis -100 34161081 The p value was -log10p in original paper.
10002377 MS HTP unambiguous human HeLa cells Mitotic exit/Early mitosis 100 34161081 The p value was -log10p in original paper.
10011947 MS HTP unambiguous human HeLa cells 30059200
10014039 MS HTP unambiguous human HeLa cells 30379171
10014040 MS HTP unambiguous human HeLa cells 30379171
10014041 MS HTP unambiguous human HeLa cells 30379171
10014042 MS HTP unambiguous human HeLa cells 30379171
10015928 MS HTP unambiguous human liver 31637018
10015929 MS HTP unambiguous human liver 31637018
10015930 MS HTP unambiguous human liver 31637018
10024179 MS HTP unambiguous human liver 31637018
10024180 MS HTP unambiguous human liver 31637018
10024181 MS HTP unambiguous human liver 31637018
10037366 MS HTP unambiguous human HEK 293T cells TMG/control -3.321928095 30620550 Peptide quantification value was applied to each modification site

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10001947 229 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10002377 229 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10011947 RDPDANWDSPSRVPFSSGQHSTQSFPPSLMS S 229 MS HTP unambiguous human HeLa cells 30059200
10014039 VTSKEDKLSSR T 42 MS HTP unambiguous human HeLa cells 30379171
10014040 VTSKEDKLSSR S 43 MS HTP unambiguous human HeLa cells 30379171
10014041 DLLPSPAGPVPSKDPKTEHGSR S 814 MS HTP unambiguous human HeLa cells 30379171
10014042 IESETPVDLASSMPSSR S 586 MS HTP unambiguous human HeLa cells 30379171
10015928 ETSGSSK S 5 854 MS HTP unambiguous human liver 31637018
10015929 ETSGSSK T 2 851 MS HTP unambiguous human liver 31637018
10015930 ETSGSSK S 6 855 MS HTP unambiguous human liver 31637018
10024179 ETSGSSK S 854 MS HTP unambiguous human liver 31637018
10024180 ETSGSSK T 851 MS HTP unambiguous human liver 31637018
10024181 ETSGSSK S 855 MS HTP unambiguous human liver 31637018
10037366 TSSSSKEVK 871 MS HTP unambiguous human HEK 293T cells 30620550 Peptide quantification value was applied to each modification site