Details for Accession #: Q9UBV2


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
10002853 610
10003524 610
10011943 FILDQREASIVGENETYPRALLHWNRAASQG T 610
10027179 EASIVGENETYPR T 10 610
10028435 EASIVGENETYPR T 10 610
10029501 EASIVGENETYPR T 10 610
10030662 T 610

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
10002853 MS HTP unambiguous human HeLa cells Mitotic exit/Early mitosis 1.960990627 0.001211 34161081 The p value was -log10p in original paper.
10003524 MS HTP unambiguous human colorectal cancer (CRC) cell lines SW620 cells/SW480 cells 0.514573173 0.046627747 35254053
10011943 MS HTP unambiguous human HeLa cells 30059200
10027179 MS HTP unambiguous human HeLa cells 35254053
10028435 MS HTP unambiguous human SW480 cells 35254053
10029501 MS HTP unambiguous human SW620 cells 35254053
10030662 MS HTP unambiguous human SW480 cells, SW620 cells SW620/SW480 0.514573173 0.046627747 35254053

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10002853 610 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10003524 610 MS HTP unambiguous human colorectal cancer (CRC) cell lines 35254053
10011943 FILDQREASIVGENETYPRALLHWNRAASQG T 610 MS HTP unambiguous human HeLa cells 30059200
10027179 EASIVGENETYPR T 10 610 MS HTP unambiguous human HeLa cells 35254053
10028435 EASIVGENETYPR T 10 610 MS HTP unambiguous human SW480 cells 35254053
10029501 EASIVGENETYPR T 10 610 MS HTP unambiguous human SW620 cells 35254053
10030662 T 610 MS HTP unambiguous human SW480 cells, SW620 cells 35254053