Details for Accession #: Q9P0T7


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
10001430 40
10005427 NISGHIYNQNVSQK S 3 40
10011932 EDIRCKCICPPYRNISGHIYNQNVSQKDCNC S 40
10022614 NISGHIYNQNVSQK S 4 40
10025220 NISGHIYNQNVSQK S 3 40
10030863 NISGHIYNQNVSQK S 12 49
10030881 NISGHIYNQNVSQK S 3 40

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
10001430 MS HTP unambiguous human HeLa cells Interphase/Mitosis 100 34161081 The p value was -log10p in original paper.
10005427 MS HTP unambiguous human HEK 293T cells glucose-deprived/glucose-sufficient 0.69 37541260
10011932 MS HTP unambiguous human HeLa cells 30059200
10022614 MS HTP unambiguous human HeLa cells 34846842
10025220 MS HTP unambiguous human HeLa cells 35254053
10030863 MS HTP unambiguous human HeLa cell nucleus 35289036
10030881 MS HTP unambiguous human HeLa cell nucleus 35289036

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10001430 40 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10005427 NISGHIYNQNVSQK S 3 40 MS HTP unambiguous human HEK 293T cells 37541260
10011932 EDIRCKCICPPYRNISGHIYNQNVSQKDCNC S 40 MS HTP unambiguous human HeLa cells 30059200
10022614 NISGHIYNQNVSQK S 4 40 MS HTP unambiguous human HeLa cells 34846842
10025220 NISGHIYNQNVSQK S 3 40 MS HTP unambiguous human HeLa cells 35254053
10030863 NISGHIYNQNVSQK S 12 49 MS HTP unambiguous human HeLa cell nucleus 35289036
10030881 NISGHIYNQNVSQK S 3 40 MS HTP unambiguous human HeLa cell nucleus 35289036