ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein |
---|---|---|---|---|
10002527 | 553 | |||
10011875 | ITHKLHKILGDKVNNTAVIEKQVLELWDRLY | T | 553 | |
10026238 | VNNTAVIEK | T | 4 | 553 |
10026417 | ILGDKVNNTAVIEK | T | 9 | 553 |
ID | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Condition | log2Ratio | P Value | Data Source PMID | Comments |
---|---|---|---|---|---|---|---|---|---|---|
10002527 | MS | HTP | unambiguous | human | HeLa cells | Mitotic exit/Early mitosis | 100 | 34161081 | The p value was -log10p in original paper. | |
10011875 | MS | HTP | unambiguous | human | HeLa cells | 30059200 | ||||
10026238 | MS | HTP | unambiguous | human | HeLa cells | 35254053 | ||||
10026417 | MS | HTP | unambiguous | human | HeLa cells | 35254053 |
ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Data Source PMID | Comments |
---|---|---|---|---|---|---|---|---|---|---|---|
10002527 | 553 | MS | HTP | unambiguous | human | HeLa cells | 34161081 | The p value was -log10p in original paper. | |||
10011875 | ITHKLHKILGDKVNNTAVIEKQVLELWDRLY | T | 553 | MS | HTP | unambiguous | human | HeLa cells | 30059200 | ||
10026238 | VNNTAVIEK | T | 4 | 553 | MS | HTP | unambiguous | human | HeLa cells | 35254053 | |
10026417 | ILGDKVNNTAVIEK | T | 9 | 553 | MS | HTP | unambiguous | human | HeLa cells | 35254053 |