Details for Accession #: Q99PP7


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
10003620 S 650
10004134 T 562
10004835 T 658
10005184 T 658
10005185 T 561
10005269 S 638
10006528 QHSNPGHAGPFPVVSAHNPINPTSPTTATMANANR S 11 350
10008279 QHSNPGHAGPFPVVSAHNPINPTSPTTATMANANR S 15 650
10017480 QHSNPGHAGPFPVVSAHNPINPTSPTTATMANANR S 15 650

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
10003620 MS HTP unambiguous mouse embryonic stem cells (ESCs) None 36852467
10004134 MS HTP unambiguous mouse embryonic stem cells (ESCs) None 36852467
10004835 MS HTP unambiguous mouse RA-induced differentiated ESCs None 36852467
10005184 MS HTP unambiguous mouse embryonic stem cells (ESCs) control/RA-induced differentiated None 0.016560837 36852467
10005185 MS HTP unambiguous mouse embryonic stem cells (ESCs) control/RA-induced differentiated None 0.000439503 36852467
10005269 MS HTP unambiguous mouse embryonic stem cells (ESCs) control/RA-induced differentiated None 0.265216579 36852467
10006528 MS HTP unambiguous mouse embryonic stem cells (ESCs) None 21606357 This position assigment in both the peptide sequence and protein sequence seems problematic, which could not be curated
10008279 MS HTP unambiguous mouse brain (synaptosome) None 22645316
10017480 MS HTP unambiguous mouse embryonic fibroblasts None 32782141

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10003620 S 650 MS HTP unambiguous mouse embryonic stem cells (ESCs) 36852467
10004134 T 562 MS HTP unambiguous mouse embryonic stem cells (ESCs) 36852467
10004835 T 658 MS HTP unambiguous mouse RA-induced differentiated ESCs 36852467
10005184 T 658 MS HTP unambiguous mouse embryonic stem cells (ESCs) 36852467
10005185 T 561 MS HTP unambiguous mouse embryonic stem cells (ESCs) 36852467
10005269 S 638 MS HTP unambiguous mouse embryonic stem cells (ESCs) 36852467
10006528 QHSNPGHAGPFPVVSAHNPINPTSPTTATMANANR S 11 350 MS HTP unambiguous mouse embryonic stem cells (ESCs) 21606357 This position assigment in both the peptide sequence and protein sequence seems problematic, which could not be curated
10008279 QHSNPGHAGPFPVVSAHNPINPTSPTTATMANANR S 15 650 MS HTP unambiguous mouse brain (synaptosome) 22645316
10017480 QHSNPGHAGPFPVVSAHNPINPTSPTTATMANANR S 15 650 MS HTP unambiguous mouse embryonic fibroblasts 32782141