| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein |
|---|---|---|---|---|
| 10003620 | S | 650 | ||
| 10004134 | T | 562 | ||
| 10004835 | T | 658 | ||
| 10005184 | T | 658 | ||
| 10005185 | T | 561 | ||
| 10005269 | S | 638 | ||
| 10006528 | QHSNPGHAGPFPVVSAHNPINPTSPTTATMANANR | S | 11 | 350 |
| 10008279 | QHSNPGHAGPFPVVSAHNPINPTSPTTATMANANR | S | 15 | 650 |
| 10017480 | QHSNPGHAGPFPVVSAHNPINPTSPTTATMANANR | S | 15 | 650 |
| ID | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Condition | log2Ratio | P Value | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|
| 10003620 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
| 10004134 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
| 10004835 | MS | HTP | unambiguous | mouse | RA-induced differentiated ESCs | None | 36852467 | |||
| 10005184 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | control/RA-induced differentiated | None | 0.016560837 | 36852467 | |
| 10005185 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | control/RA-induced differentiated | None | 0.000439503 | 36852467 | |
| 10005269 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | control/RA-induced differentiated | None | 0.265216579 | 36852467 | |
| 10006528 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 21606357 | This position assigment in both the peptide sequence and protein sequence seems problematic, which could not be curated | ||
| 10008279 | MS | HTP | unambiguous | mouse | brain (synaptosome) | None | 22645316 | |||
| 10017480 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | None | 32782141 |
| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 10003620 | S | 650 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
| 10004134 | T | 562 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
| 10004835 | T | 658 | MS | HTP | unambiguous | mouse | RA-induced differentiated ESCs | 36852467 | |||
| 10005184 | T | 658 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
| 10005185 | T | 561 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
| 10005269 | S | 638 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
| 10006528 | QHSNPGHAGPFPVVSAHNPINPTSPTTATMANANR | S | 11 | 350 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 21606357 | This position assigment in both the peptide sequence and protein sequence seems problematic, which could not be curated |
| 10008279 | QHSNPGHAGPFPVVSAHNPINPTSPTTATMANANR | S | 15 | 650 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | |
| 10017480 | QHSNPGHAGPFPVVSAHNPINPTSPTTATMANANR | S | 15 | 650 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 |