| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein |
|---|---|---|---|---|
| 6718 | TVIAHTSPWTPVVTTSTQTK | S | 7 | 1186 |
| 10006538 | TVIAHTSPWTPVVTTSTQTK | T | 6 | 1368 |
| 10006539 | TVIAHTSPWTPVVTTSTQTK | S | 7 | 1369 |
| 10007286 | SPSSTESLQPTVKQSDQPVAAYEYYDAGSHWCK | S | 7 | 1065 |
| 10007984 | VLENFDTTHLEVEGFASLRNLGDMHANFHNSQTEQTR | T | 36 | 1985 |
| 10007985 | TVIAHTSPWTPVVTTSTQTK | T | 14 | 1366 |
| 10007986 | TVIAHTSPWTPVVTTSTQTK | T | 6 | 1358 |
| 10007987 | SPSSTESLQPTVKQSDQPVAAYEYYDAGSHWCK | T | 5 | 1063 |
| 10017479 | TVIAHTSPWTPVVTTSTQTK | T | 6 | 1185 |
| ID | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Condition | log2Ratio | P Value | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|
| 6718 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
| 10006538 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 21606357 | This site was described as T1185 in the original paper | ||
| 10006539 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 21606357 | This site was described as S1186 in the original paper | ||
| 10007286 | MS | HTP | unambiguous | mouse | brain (synaptosome) | None | 22645316 | |||
| 10007984 | MS | HTP | unambiguous | mouse | brain (synaptosome) | None | 22645316 | |||
| 10007985 | MS | HTP | unambiguous | mouse | brain (synaptosome) | None | 22645316 | |||
| 10007986 | MS | HTP | unambiguous | mouse | brain (synaptosome) | None | 22645316 | |||
| 10007987 | MS | HTP | unambiguous | mouse | brain (synaptosome) | None | 22645316 | |||
| 10017479 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | None | 32782141 |
| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 6718 | TVIAHTSPWTPVVTTSTQTK | S | 7 | 1186 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10006538 | TVIAHTSPWTPVVTTSTQTK | T | 6 | 1368 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 21606357 | This site was described as T1185 in the original paper |
| 10006539 | TVIAHTSPWTPVVTTSTQTK | S | 7 | 1369 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 21606357 | This site was described as S1186 in the original paper |
| 10007286 | SPSSTESLQPTVKQSDQPVAAYEYYDAGSHWCK | S | 7 | 1065 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | |
| 10007984 | VLENFDTTHLEVEGFASLRNLGDMHANFHNSQTEQTR | T | 36 | 1985 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | |
| 10007985 | TVIAHTSPWTPVVTTSTQTK | T | 14 | 1366 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | |
| 10007986 | TVIAHTSPWTPVVTTSTQTK | T | 6 | 1358 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | |
| 10007987 | SPSSTESLQPTVKQSDQPVAAYEYYDAGSHWCK | T | 5 | 1063 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | |
| 10017479 | TVIAHTSPWTPVVTTSTQTK | T | 6 | 1185 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 |