Details for Accession #: Q92540


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
4246 KTPVSEAR T 624
10001134 YPNNSMFNEVYGK S 5 948
10002452 948
10003133 627
10003134 624
10003448 632
10010142 KTPVSEAR S 5 627
10011764 AVQVKSQTELRKTPVSEARKTPVTQTPTQAS S 627
10011765 SLTGFSLNQERYPNNSMFNEVYGKNLTSSSK S 948
10013648 KTPVSEAR S 627
10015522 YPNNSMFNEVYGK S 5 948
10016314 KTPVSEAR S 5 627
10016645 YPNNSMFNEVYGK S 5 948
10016786 TPVSEAR T 1 624
10024961 YPNNSMFNEVYGK S 5 948
10025317 KTPVSEAR S 5 627
10026393 KTPVSEAR T 2 624
10026869 TPVSEAR T 1 624
10026870 KTPVTQTPTQASNSQFIPIHHPGAFPPLPSR T 2 632
10027154 YPNNSMFNEVYGK S 5 948
10028311 KTPVSEAR S 5 627
10028671 TPVTQTPTQASNSQFIPIHHPGAFPPLPSR T 1 632
10029334 KTPVSEAR T 2 624
10029335 KTPVSEAR S 5 627
10029336 TPVTQTPTQASNSQFIPIHHPGAFPPLPSR T 1 632
10030000 YPNNSMFNEVYGK S 5 948
10030291 S 627
10030292 T 624
10030588 T 632
10032029 YPNNSMFNEVYGK S 5 948
10032558 KTPVSEAR S 627
10033045 YPNNSMFNEVYGK S 5 948
10033113 TPVSEAR S 4 627
10036712 KTPVSEAR S 627
10036713 YPNNSMFNEVYGK S 948
10039259 S 948
10042469 S 627
10042718 S 627
10043186 S 948
10043187 S 948
10043188 S 948
10043189 S 948

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
4246 MS HTP ambiguous human T cells None 29351928
10001134 MS HTP unambiguous human HeLa cells 20 uM GalNAz/200 uM GalNAz None 30059200
10002452 MS HTP unambiguous human HeLa cells Mitotic exit/Early mitosis None 34161081 The p value was -log10p in original paper.
10003133 MS HTP unambiguous human colorectal cancer (CRC) cell lines SW620 cells/SW480 cells None 0.00087121 35254053
10003134 MS HTP unambiguous human colorectal cancer (CRC) cell lines SW620 cells/SW480 cells None 0.001323422 35254053
10003448 MS HTP unambiguous human colorectal cancer (CRC) cell lines SW620 cells/SW480 cells None 0.2656195 35254053
10010142 MS HTP unambiguous human T cells None 29351928
10011764 MS HTP unambiguous human HeLa cells None 30059200
10011765 MS HTP unambiguous human HeLa cells None 30059200
10013648 MS HTP unambiguous human HeLa cells None 30379171
10015522 MS HTP unambiguous human HeLa cells None 31492838
10016314 MS HTP unambiguous human MCF-7 cells None 32574038
10016645 MS HTP unambiguous human MCF-7 cells None 32574038
10016786 MS HTP unambiguous human MCF-7 cells None 32574038
10024961 MS HTP unambiguous human Jurkat cells, MCF-7 cells, K562 cells None 35132862
10025317 MS HTP unambiguous human HeLa cells None 35254053
10026393 MS HTP unambiguous human HeLa cells None 35254053
10026869 MS HTP unambiguous human HeLa cells None 35254053
10026870 MS HTP unambiguous human HeLa cells None 35254053
10027154 MS HTP unambiguous human HeLa cells None 35254053
10028311 MS HTP unambiguous human SW480 cells None 35254053
10028671 MS HTP unambiguous human SW480 cells None 35254053
10029334 MS HTP unambiguous human SW620 cells None 35254053
10029335 MS HTP unambiguous human SW620 cells None 35254053
10029336 MS HTP unambiguous human SW620 cells None 35254053
10030000 MS HTP unambiguous human SW620 cells None 35254053
10030291 MS HTP unambiguous human SW480 cells, SW620 cells SW620/SW480 None 0.00087121 35254053
10030292 MS HTP unambiguous human SW480 cells, SW620 cells SW620/SW480 None 0.001323422 35254053
10030588 MS HTP unambiguous human SW480 cells, SW620 cells SW620/SW480 None 0.2656195 35254053
10032029 MS HTP unambiguous human HeLa cell nucleus None 35289036
10032558 MS HTP unambiguous human MCF-7 cells None 35513511
10033045 MS HTP unambiguous human Jurkat cells None 35705054
10033113 MS HTP unambiguous human Jurkat cells None 35705054
10036712 MS HTP unambiguous human HEK 293T cells None 30620550
10036713 MS HTP unambiguous human HEK 293T cells None 30620550
10039259 MS HTP unambiguous human PANC-1 cells None 39302247
10042469 MS HTP unambiguous human Flp-In T-REx-293 cells OGA_S652F/WT None 0.18 38838015
10042718 MS HTP unambiguous human Flp-In T-REx-293 cells OGA_R586A/WT None 0.32 38838015
10043186 MS HTP unambiguous human HeLa cells: cytoplasm cytoplasm: 100 uM H2O2/control None 39534244
10043187 MS HTP unambiguous human HeLa cells: cytoplasm cytoplasm: 100 mM H2O2/control None 39534244
10043188 MS HTP unambiguous human HeLa cells: nucleus nucleus: 100 uM H2O2/control None 39534244
10043189 MS HTP unambiguous human HeLa cells: nucleus nucleus: 100 MM H2O2/control None 39534244

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
4246 KTPVSEAR T 624 MS HTP ambiguous human T cells 29351928
10001134 YPNNSMFNEVYGK S 5 948 MS HTP unambiguous human HeLa cells 30059200
10002452 948 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10003133 627 MS HTP unambiguous human colorectal cancer (CRC) cell lines 35254053
10003134 624 MS HTP unambiguous human colorectal cancer (CRC) cell lines 35254053
10003448 632 MS HTP unambiguous human colorectal cancer (CRC) cell lines 35254053
10010142 KTPVSEAR S 5 627 MS HTP unambiguous human T cells 29351928
10011764 AVQVKSQTELRKTPVSEARKTPVTQTPTQAS S 627 MS HTP unambiguous human HeLa cells 30059200
10011765 SLTGFSLNQERYPNNSMFNEVYGKNLTSSSK S 948 MS HTP unambiguous human HeLa cells 30059200
10013648 KTPVSEAR S 627 MS HTP unambiguous human HeLa cells 30379171
10015522 YPNNSMFNEVYGK S 5 948 MS HTP unambiguous human HeLa cells 31492838
10016314 KTPVSEAR S 5 627 MS HTP unambiguous human MCF-7 cells 32574038
10016645 YPNNSMFNEVYGK S 5 948 MS HTP unambiguous human MCF-7 cells 32574038
10016786 TPVSEAR T 1 624 MS HTP unambiguous human MCF-7 cells 32574038
10024961 YPNNSMFNEVYGK S 5 948 MS HTP unambiguous human Jurkat cells, MCF-7 cells, K562 cells 35132862
10025317 KTPVSEAR S 5 627 MS HTP unambiguous human HeLa cells 35254053
10026393 KTPVSEAR T 2 624 MS HTP unambiguous human HeLa cells 35254053
10026869 TPVSEAR T 1 624 MS HTP unambiguous human HeLa cells 35254053
10026870 KTPVTQTPTQASNSQFIPIHHPGAFPPLPSR T 2 632 MS HTP unambiguous human HeLa cells 35254053
10027154 YPNNSMFNEVYGK S 5 948 MS HTP unambiguous human HeLa cells 35254053
10028311 KTPVSEAR S 5 627 MS HTP unambiguous human SW480 cells 35254053
10028671 TPVTQTPTQASNSQFIPIHHPGAFPPLPSR T 1 632 MS HTP unambiguous human SW480 cells 35254053
10029334 KTPVSEAR T 2 624 MS HTP unambiguous human SW620 cells 35254053
10029335 KTPVSEAR S 5 627 MS HTP unambiguous human SW620 cells 35254053
10029336 TPVTQTPTQASNSQFIPIHHPGAFPPLPSR T 1 632 MS HTP unambiguous human SW620 cells 35254053
10030000 YPNNSMFNEVYGK S 5 948 MS HTP unambiguous human SW620 cells 35254053
10030291 S 627 MS HTP unambiguous human SW480 cells, SW620 cells 35254053
10030292 T 624 MS HTP unambiguous human SW480 cells, SW620 cells 35254053
10030588 T 632 MS HTP unambiguous human SW480 cells, SW620 cells 35254053
10032029 YPNNSMFNEVYGK S 5 948 MS HTP unambiguous human HeLa cell nucleus 35289036
10032558 KTPVSEAR S 627 MS HTP unambiguous human MCF-7 cells 35513511
10033045 YPNNSMFNEVYGK S 5 948 MS HTP unambiguous human Jurkat cells 35705054
10033113 TPVSEAR S 4 627 MS HTP unambiguous human Jurkat cells 35705054
10036712 KTPVSEAR S 627 MS HTP unambiguous human HEK 293T cells 30620550
10036713 YPNNSMFNEVYGK S 948 MS HTP unambiguous human HEK 293T cells 30620550
10039259 S 948 MS HTP unambiguous human PANC-1 cells 39302247
10042469 S 627 MS HTP unambiguous human Flp-In T-REx-293 cells 38838015
10042718 S 627 MS HTP unambiguous human Flp-In T-REx-293 cells 38838015
10043186 S 948 MS HTP unambiguous human HeLa cells: cytoplasm 39534244
10043187 S 948 MS HTP unambiguous human HeLa cells: cytoplasm 39534244
10043188 S 948 MS HTP unambiguous human HeLa cells: nucleus 39534244
10043189 S 948 MS HTP unambiguous human HeLa cells: nucleus 39534244