Details for Accession #: Q8N0X7


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
10000713 IQPEEKPVEVSPAVTK T 15 474
10001108 IQPEEKPVEVSPAVTK T 15 474
10002855 474
10011707 RIQPEEKPVEVSPAVTKGLYIAKQATGGAAK T 474
10015474 IQPEEKPVEVSPAVTK T 15 474
10019666 IQPEEKPVEVSPAVTK T 474
10023812 IQPEEKPVEVSPAVTK T 15 474
10025273 IQPEEKPVEVSPAVTK T 15 474
10032760 IQPEEKPVEVSPAVTK T 474
10033731 IQPEEKPVEVSPAVTK T 15 474
10037112 IQPEEKPVEVSPAVTK 474
10037299 IQPEEKPVEVSPAVTK 474
10041463 T 474

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
10000713 MS HTP unambiguous human brain Alzheimers disease/control None 0.530805706 28657654
10001108 MS HTP unambiguous human HeLa cells 20 uM GalNAz/200 uM GalNAz None 30059200
10002855 MS HTP unambiguous human HeLa cells Mitotic exit/Early mitosis None 0.009675 34161081 The p value was -log10p in original paper.
10011707 MS HTP unambiguous human HeLa cells None 30059200
10015474 MS HTP unambiguous human HeLa cells None 31492838
10019666 MS HTP unambiguous human Hela cells None 29237092
10023812 MS HTP unambiguous human THP1 cells None 32938750
10025273 MS HTP unambiguous human HeLa cells None 35254053
10032760 MS HTP unambiguous human MCF-7 cells None 35513511
10033731 MS HTP unambiguous human HEK 293T cells glucose-deprived/glucose-sufficient None 37541260
10037112 MS HTP unambiguous human HepG2 cells None 30620550
10037299 MS HTP unambiguous human HEK 293T cells TMG/control None 30620550 Peptide quantification value was applied to each modification site
10041463 MS HTP unambiguous human PANC-1 cells None 39531497

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10000713 IQPEEKPVEVSPAVTK T 15 474 MS HTP unambiguous human brain 28657654
10001108 IQPEEKPVEVSPAVTK T 15 474 MS HTP unambiguous human HeLa cells 30059200
10002855 474 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10011707 RIQPEEKPVEVSPAVTKGLYIAKQATGGAAK T 474 MS HTP unambiguous human HeLa cells 30059200
10015474 IQPEEKPVEVSPAVTK T 15 474 MS HTP unambiguous human HeLa cells 31492838
10019666 IQPEEKPVEVSPAVTK T 474 MS HTP unambiguous human Hela cells 29237092
10023812 IQPEEKPVEVSPAVTK T 15 474 MS HTP unambiguous human THP1 cells 32938750
10025273 IQPEEKPVEVSPAVTK T 15 474 MS HTP unambiguous human HeLa cells 35254053
10032760 IQPEEKPVEVSPAVTK T 474 MS HTP unambiguous human MCF-7 cells 35513511
10033731 IQPEEKPVEVSPAVTK T 15 474 MS HTP unambiguous human HEK 293T cells 37541260
10037112 IQPEEKPVEVSPAVTK 474 MS HTP unambiguous human HepG2 cells 30620550
10037299 IQPEEKPVEVSPAVTK 474 MS HTP unambiguous human HEK 293T cells 30620550 Peptide quantification value was applied to each modification site
10041463 T 474 MS HTP unambiguous human PANC-1 cells 39531497