Details for Accession #: Q8BIZ1


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
10008044 KSVAPQTSCPNR S 8 317
10008045 NFPMEMEPSASLDTFPSENENFLCELVDTAVTK S 9 440
10008191 NFPMEMEPSASLDTFPSENENFLCELVDTAVTK S 11 442
10021729 YETTIF T 4 1257

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
10008044 MS HTP unambiguous mouse brain (synaptosome) None 22645316 The original accession E9Q2H9 is obsolete in UniProt, with the new accession Q8BIZ1 assigned; this modfication in the protein sequence seems problematic, which can not be curated
10008045 MS HTP unambiguous mouse brain (synaptosome) None 22645316
10008191 MS HTP unambiguous mouse brain (synaptosome) None 22645316
10021729 MS HTP unambiguous mouse synaptosome None 34678516

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10008044 KSVAPQTSCPNR S 8 317 MS HTP unambiguous mouse brain (synaptosome) 22645316 The original accession E9Q2H9 is obsolete in UniProt, with the new accession Q8BIZ1 assigned; this modfication in the protein sequence seems problematic, which can not be curated
10008045 NFPMEMEPSASLDTFPSENENFLCELVDTAVTK S 9 440 MS HTP unambiguous mouse brain (synaptosome) 22645316
10008191 NFPMEMEPSASLDTFPSENENFLCELVDTAVTK S 11 442 MS HTP unambiguous mouse brain (synaptosome) 22645316
10021729 YETTIF T 4 1257 MS HTP unambiguous mouse synaptosome 34678516