Details for Accession #: Q76L83


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
10001530 905
10001959 907
10002389 907
10003097 411
10011625 KVKKTPAEQPKSMPVSEASLIRIVPVVSQSE S 415
10015407 SMPVSEASLIR S 5 415
10021350 411
10023752 LPVPQVSATTAPAGSAPPSSTLPAASSLK S 7 905
10023753 LPVPQVSATTAPAGSAPPSSTLPAASSLK T 9 907
10025447 SMPVSEASLIR S 5 415
10026825 SMPVSEASLIR S 1 411
10027274 LPVPQVSATTAPAGSAPPSSTLPAASSLK T 9 907
10027511 LPVPQVSATTAPAGSAPPSSTLPAASSLK S 7 905
10028236 SMPVSEASLIR S 1 411
10029255 SMPVSEASLIR S 1 411
10030255 S 411
10031955 SMPVSEASLIR S 5 415
10031956 SMPVSEASLIR S 1 411
10032501 VPPLKIPVSR S 624
10036778 SMPVSEASLIR 411

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
10001530 MS HTP unambiguous human HeLa cells Interphase/Mitosis None 34161081 The p value was -log10p in original paper.
10001959 MS HTP unambiguous human HeLa cells Interphase/Mitosis None 34161081 The p value was -log10p in original paper.
10002389 MS HTP unambiguous human HeLa cells Mitotic exit/Early mitosis None 34161081 The p value was -log10p in original paper.
10003097 MS HTP unambiguous human colorectal cancer (CRC) cell lines SW620 cells/SW480 cells None 0.00868218 35254053
10011625 MS HTP unambiguous human HeLa cells None 30059200
10015407 MS HTP unambiguous human HeLa cells None 31492838
10021350 MS HTP unambiguous human HeLa cells None 34161081
10023752 MS HTP unambiguous human THP1 cells None 32938750
10023753 MS HTP unambiguous human THP1 cells None 32938750
10025447 MS HTP unambiguous human HeLa cells None 35254053
10026825 MS HTP unambiguous human HeLa cells None 35254053
10027274 MS HTP unambiguous human HeLa cells None 35254053
10027511 MS HTP unambiguous human HeLa cells None 35254053
10028236 MS HTP unambiguous human SW480 cells None 35254053
10029255 MS HTP unambiguous human SW620 cells None 35254053
10030255 MS HTP unambiguous human SW480 cells, SW620 cells SW620/SW480 None 0.00868218 35254053
10031955 MS HTP unambiguous human HeLa cell nucleus None 35289036
10031956 MS HTP unambiguous human HeLa cell nucleus None 35289036
10032501 MS HTP unambiguous human MCF-7 cells None 35513511
10036778 MS HTP unambiguous human HepG2 cells None 30620550

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10001530 905 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10001959 907 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10002389 907 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10003097 411 MS HTP unambiguous human colorectal cancer (CRC) cell lines 35254053
10011625 KVKKTPAEQPKSMPVSEASLIRIVPVVSQSE S 415 MS HTP unambiguous human HeLa cells 30059200
10015407 SMPVSEASLIR S 5 415 MS HTP unambiguous human HeLa cells 31492838
10021350 411 MS HTP unambiguous human HeLa cells 34161081
10023752 LPVPQVSATTAPAGSAPPSSTLPAASSLK S 7 905 MS HTP unambiguous human THP1 cells 32938750
10023753 LPVPQVSATTAPAGSAPPSSTLPAASSLK T 9 907 MS HTP unambiguous human THP1 cells 32938750
10025447 SMPVSEASLIR S 5 415 MS HTP unambiguous human HeLa cells 35254053
10026825 SMPVSEASLIR S 1 411 MS HTP unambiguous human HeLa cells 35254053
10027274 LPVPQVSATTAPAGSAPPSSTLPAASSLK T 9 907 MS HTP unambiguous human HeLa cells 35254053
10027511 LPVPQVSATTAPAGSAPPSSTLPAASSLK S 7 905 MS HTP unambiguous human HeLa cells 35254053
10028236 SMPVSEASLIR S 1 411 MS HTP unambiguous human SW480 cells 35254053
10029255 SMPVSEASLIR S 1 411 MS HTP unambiguous human SW620 cells 35254053
10030255 S 411 MS HTP unambiguous human SW480 cells, SW620 cells 35254053
10031955 SMPVSEASLIR S 5 415 MS HTP unambiguous human HeLa cell nucleus 35289036
10031956 SMPVSEASLIR S 1 411 MS HTP unambiguous human HeLa cell nucleus 35289036
10032501 VPPLKIPVSR S 624 MS HTP unambiguous human MCF-7 cells 35513511
10036778 SMPVSEASLIR 411 MS HTP unambiguous human HepG2 cells 30620550