Details for Accession #: Q75N03


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
3838 SVSQETFR S 278
10001071 SVSQETFR S 1 276
10011624 RAPPAELSMAPPPPRSVSQETFRISTRKHSN S 276
10015406 SVSQETFR S 1 276
10016593 SVSQETFR S 1 276
10022989 SVSQETFR S 2 276
10025266 SVSQETFR S 1 276
10031349 SVSQETFR S 3 278
10031350 SVSQETFR S 1 276
10036789 SVSQETFR 276
10037143 SVSQETFR 276

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
3838 MS HTP ambiguous human T cells None 29351928
10001071 MS HTP unambiguous human HeLa cells 20 uM GalNAz/200 uM GalNAz None 30059200
10011624 MS HTP unambiguous human HeLa cells None 30059200
10015406 MS HTP unambiguous human HeLa cells None 31492838
10016593 MS HTP unambiguous human MCF-7 cells None 32574038
10022989 MS HTP unambiguous human HeLa cells None 34846842
10025266 MS HTP unambiguous human HeLa cells None 35254053
10031349 MS HTP unambiguous human HeLa cell nucleus None 35289036
10031350 MS HTP unambiguous human HeLa cell nucleus None 35289036
10036789 MS HTP unambiguous human HepG2 cells None 30620550
10037143 MS HTP unambiguous human HEK 293T cells TMG/control None 30620550 Peptide quantification value was applied to each modification site

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
3838 SVSQETFR S 278 MS HTP ambiguous human T cells 29351928
10001071 SVSQETFR S 1 276 MS HTP unambiguous human HeLa cells 30059200
10011624 RAPPAELSMAPPPPRSVSQETFRISTRKHSN S 276 MS HTP unambiguous human HeLa cells 30059200
10015406 SVSQETFR S 1 276 MS HTP unambiguous human HeLa cells 31492838
10016593 SVSQETFR S 1 276 MS HTP unambiguous human MCF-7 cells 32574038
10022989 SVSQETFR S 2 276 MS HTP unambiguous human HeLa cells 34846842
10025266 SVSQETFR S 1 276 MS HTP unambiguous human HeLa cells 35254053
10031349 SVSQETFR S 3 278 MS HTP unambiguous human HeLa cell nucleus 35289036
10031350 SVSQETFR S 1 276 MS HTP unambiguous human HeLa cell nucleus 35289036
10036789 SVSQETFR 276 MS HTP unambiguous human HepG2 cells 30620550
10037143 SVSQETFR 276 MS HTP unambiguous human HEK 293T cells 30620550 Peptide quantification value was applied to each modification site