Details for Accession #: Q6Y7W6


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
10001067 LSGWGNVSKPSGTTK S 8 993
10001068 ISDQNIIPSVTR T 11 680
10001742 680
10003096 680
10009424 ISDQNIIPSVTR T 11 680
10011616 TLKMRISDQNIIPSVTRSVSVPDTGSIWELQ T 680
10011617 QQQQQQQKLSGWGNVSKPSGTTKSLLEIQQE S 993
10013329 NFSMSVNSAAVLR S 98
10015399 LSGWGNVSKPSGTTK S 8 993
10015400 ISDQNIIPSVTR T 11 680
10019482 LSGWGNVSKPSGTTK S 993
10019662 ISDQNIIPSVTR T 680
10021411 374
10023747 ISDQNIIPSVTR T 11 680
10024838 ISDQNIIPSVTR S 9 678
10025452 ISDQNIIPSVTR T 11 680
10027050 LSGWGNVSKPSGTTK S 8 993
10027199 VGVEASEETPQTSSSSAR S 13 374
10028232 ISDQNIIPSVTR T 11 680
10029251 ISDQNIIPSVTR T 11 680
10030254 T 680
10032498 LSGWGNVSKPSGTTK S 993
10032748 ISDQNIIPSVTR T 680
10033614 ISDQNIIPSVTR T 11 680
10037296 ISDQNIIPSVTR 680
10037491 ISDQNIIPSVTR 678
10037492 ISDQNIIPSVTR 680
10037881 S 121
10037882 T 112
10039534 T 680
10045112 LSGWGNVSKPSGTTK S 8 993
10046005 LSGWGNVSKPSGTTK S 11 996

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
10001067 MS HTP unambiguous human HeLa cells 20 uM GalNAz/200 uM GalNAz None 30059200
10001068 MS HTP unambiguous human HeLa cells 20 uM GalNAz/200 uM GalNAz None 30059200
10001742 MS HTP unambiguous human HeLa cells Interphase/Mitosis None 0.023225 34161081 The p value was -log10p in original paper.
10003096 MS HTP unambiguous human colorectal cancer (CRC) cell lines SW620 cells/SW480 cells None 0.00087121 35254053
10009424 MS HTP unambiguous human brain None 28657654
10011616 MS HTP unambiguous human HeLa cells None 30059200
10011617 MS HTP unambiguous human HeLa cells None 30059200
10013329 MS HTP unambiguous human HeLa cells None 30379171
10015399 MS HTP unambiguous human HeLa cells None 31492838
10015400 MS HTP unambiguous human HeLa cells None 31492838
10019482 MS HTP unambiguous human Hela cells None 29237092
10019662 MS HTP unambiguous human Hela cells None 29237092
10021411 MS HTP unambiguous human HeLa cells None 34161081
10023747 MS HTP unambiguous human THP1 cells None 32938750
10024838 MS HTP unambiguous human Jurkat cells, MCF-7 cells, K562 cells None 35132862
10025452 MS HTP unambiguous human HeLa cells None 35254053
10027050 MS HTP unambiguous human HeLa cells None 35254053
10027199 MS HTP unambiguous human HeLa cells None 35254053
10028232 MS HTP unambiguous human SW480 cells None 35254053
10029251 MS HTP unambiguous human SW620 cells None 35254053
10030254 MS HTP unambiguous human SW480 cells, SW620 cells SW620/SW480 None 0.00087121 35254053
10032498 MS HTP unambiguous human MCF-7 cells None 35513511
10032748 MS HTP unambiguous human MCF-7 cells None 35513511
10033614 MS HTP unambiguous human HEK 293T cells glucose-deprived/glucose-sufficient None 37541260
10037296 MS HTP unambiguous human HEK 293T cells TMG/control None 30620550 Peptide quantification value was applied to each modification site
10037491 MS HTP unambiguous human HepG2 cells orafenib sensitive/resistant None 30620550 Peptide quantification value was applied to each modification site
10037492 MS HTP unambiguous human HepG2 cells orafenib sensitive/resistant None 30620550 Peptide quantification value was applied to each modification site
10037881 MS HTP unambiguous human placenta None 38253038
10037882 MS HTP unambiguous human placenta None 38253038
10039534 MS HTP unambiguous human PANC-1 cells None 39531497
10045112 MS HTP unambiguous human HeLa cells: nucleus None 39534244
10046005 MS HTP unambiguous human HeLa cells: nucleus None 39534244

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10001067 LSGWGNVSKPSGTTK S 8 993 MS HTP unambiguous human HeLa cells 30059200
10001068 ISDQNIIPSVTR T 11 680 MS HTP unambiguous human HeLa cells 30059200
10001742 680 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10003096 680 MS HTP unambiguous human colorectal cancer (CRC) cell lines 35254053
10009424 ISDQNIIPSVTR T 11 680 MS HTP unambiguous human brain 28657654
10011616 TLKMRISDQNIIPSVTRSVSVPDTGSIWELQ T 680 MS HTP unambiguous human HeLa cells 30059200
10011617 QQQQQQQKLSGWGNVSKPSGTTKSLLEIQQE S 993 MS HTP unambiguous human HeLa cells 30059200
10013329 NFSMSVNSAAVLR S 98 MS HTP unambiguous human HeLa cells 30379171
10015399 LSGWGNVSKPSGTTK S 8 993 MS HTP unambiguous human HeLa cells 31492838
10015400 ISDQNIIPSVTR T 11 680 MS HTP unambiguous human HeLa cells 31492838
10019482 LSGWGNVSKPSGTTK S 993 MS HTP unambiguous human Hela cells 29237092
10019662 ISDQNIIPSVTR T 680 MS HTP unambiguous human Hela cells 29237092
10021411 374 MS HTP unambiguous human HeLa cells 34161081
10023747 ISDQNIIPSVTR T 11 680 MS HTP unambiguous human THP1 cells 32938750
10024838 ISDQNIIPSVTR S 9 678 MS HTP unambiguous human Jurkat cells, MCF-7 cells, K562 cells 35132862
10025452 ISDQNIIPSVTR T 11 680 MS HTP unambiguous human HeLa cells 35254053
10027050 LSGWGNVSKPSGTTK S 8 993 MS HTP unambiguous human HeLa cells 35254053
10027199 VGVEASEETPQTSSSSAR S 13 374 MS HTP unambiguous human HeLa cells 35254053
10028232 ISDQNIIPSVTR T 11 680 MS HTP unambiguous human SW480 cells 35254053
10029251 ISDQNIIPSVTR T 11 680 MS HTP unambiguous human SW620 cells 35254053
10030254 T 680 MS HTP unambiguous human SW480 cells, SW620 cells 35254053
10032498 LSGWGNVSKPSGTTK S 993 MS HTP unambiguous human MCF-7 cells 35513511
10032748 ISDQNIIPSVTR T 680 MS HTP unambiguous human MCF-7 cells 35513511
10033614 ISDQNIIPSVTR T 11 680 MS HTP unambiguous human HEK 293T cells 37541260
10037296 ISDQNIIPSVTR 680 MS HTP unambiguous human HEK 293T cells 30620550 Peptide quantification value was applied to each modification site
10037491 ISDQNIIPSVTR 678 MS HTP unambiguous human HepG2 cells 30620550 Peptide quantification value was applied to each modification site
10037492 ISDQNIIPSVTR 680 MS HTP unambiguous human HepG2 cells 30620550 Peptide quantification value was applied to each modification site
10037881 S 121 MS HTP unambiguous human placenta 38253038
10037882 T 112 MS HTP unambiguous human placenta 38253038
10039534 T 680 MS HTP unambiguous human PANC-1 cells 39531497
10045112 LSGWGNVSKPSGTTK S 8 993 MS HTP unambiguous human HeLa cells: nucleus 39534244
10046005 LSGWGNVSKPSGTTK S 11 996 MS HTP unambiguous human HeLa cells: nucleus 39534244