Details for Accession #: Q5VWN6


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
3684 HFPSVIFAGVDSPGDVLDHTYQELFRAGGFVISDDK S 2264
3685 HPVSTSENAR T 1098
3686 HPVSTSENAR S 1099
10001573 971
10002821 967
10002877 1150
10002894 969
10003383 1150
10003384 969
10005583 ETPLPVSLPSDK S 7 1150
10009411 ETPLPVSLPSDK S 7 1150
10010116 HPVSTSENAR S 4 1097
10016217 VASYSGTVTQATFTR T 14 978
10016218 HPVSTSENAR S 4 1097
10016219 ETPLPVSLPSDK S 10 1153
10016572 VASYSGTVTQATFTR T 12 976
10016761 HPVSTSENAR T 5 1098
10021162 1595
10021366 1590
10021381 1556
10021416 978
10022415 VASYSGTVTQATFTR T 13 976
10022577 ETPLPVSLPSDK T 3 1145
10022728 ETPLPVSLPSDK S 8 1150
10023040 HPVSTSENAR S 5 1097
10023053 HPVSTSENAR T 6 1098
10023232 VASYSGTVTQATFTR T 15 978
10023706 ETPLPVSLPSDK S 7 1150
10023707 VASYSGTVTQATFTR S 5 969
10025538 VASYSGTVTQATFTR S 5 969
10025562 SLSDTLVSTTAPSGIVNVSVK T 10 1595
10025626 VASYSGTVTQATFTR S 3 967
10025730 ETPLPVSLPSDK S 7 1150
10025983 ETPLPVSLPSDK T 2 1145
10026184 VASYSGTVTQATFTR T 9 973
10026805 VASYSGTVTQATFTR T 7 971
10026806 HPVSTSENAR S 4 1097
10027040 SGNPLQPVSIENR S 9 1556
10027800 HPVSTSENAR T 5 1098
10028205 VASYSGTVTQATFTR S 5 969
10028206 ETPLPVSLPSDK S 7 1150
10028207 SLSDTLVSTTAPSGIVNVSVK T 10 1595
10028614 VASYSGTVTQATFTR S 3 967
10029206 ETPLPVSLPSDK S 7 1150
10029728 VASYSGTVTQATFTR S 5 969
10029970 HPVSTSENAR T 5 1098
10030527 S 1150
10030528 S 969
10030803 ETPLPVSLPSDK S 10 1153
10031047 ETPLPVSLPSDK T 2 1145
10031908 SSQNHLFPGDLK S 1 1613
10031909 TPVSEAR T 1 549
10032470 HPVSTSENAR S 1097
10033100 ETPLPVSLPSDK S 7 1150
10036351 HPVSTSENAR S 1097
10036352 HPVSTSENAR T 1098
10036353 SGNPLQPVSIENR S 1556
10036354 SLSDTLVSTTAPSGIVNVSVK T 1595
10036609 VASYSGTVTQATFTR S 969
10036814 HPVSTSENAR 1098
10037073 HPVSTSENAR 1097
10037278 ETPLPVSLPSDK 1150
10037279 ETPLPVSLPSDK 1153
10037435 ETPLPVSLPSDK 1150
10039385 S 969
10040704 S 1150
10040705 T 1594
10040898 T 1595
10042096 S 967

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
3684 MS HTP ambiguous human T cells None 29351928
3685 MS HTP ambiguous human T cells None 29351928
3686 MS HTP ambiguous human T cells None 29351928
10001573 MS HTP unambiguous human HeLa cells Interphase/Mitosis None 34161081 The p value was -log10p in original paper.
10002821 MS HTP unambiguous human HeLa cells Mitotic exit/Early mitosis None 34161081 The p value was -log10p in original paper.
10002877 MS HTP unambiguous human HeLa cells Mitotic exit/Early mitosis None 0.001121 34161081 The p value was -log10p in original paper.
10002894 MS HTP unambiguous human HeLa cells Mitotic exit/Early mitosis None 0.005478 34161081 The p value was -log10p in original paper.
10003383 MS HTP unambiguous human colorectal cancer (CRC) cell lines SW620 cells/SW480 cells None 0.003904135 35254053
10003384 MS HTP unambiguous human colorectal cancer (CRC) cell lines SW620 cells/SW480 cells None 0.020054797 35254053
10005583 MS HTP unambiguous human HEK 293T cells glucose-deprived/glucose-sufficient None 37541260
10009411 MS HTP unambiguous human brain None 28657654
10010116 MS HTP unambiguous human T cells None 29351928
10016217 MS HTP unambiguous human MCF-7 cells None 32574038
10016218 MS HTP unambiguous human MCF-7 cells None 32574038
10016219 MS HTP unambiguous human MCF-7 cells None 32574038
10016572 MS HTP unambiguous human MCF-7 cells None 32574038
10016761 MS HTP unambiguous human MCF-7 cells None 32574038
10021162 MS HTP unambiguous human HeLa cells None 34161081
10021366 MS HTP unambiguous human HeLa cells None 34161081
10021381 MS HTP unambiguous human HeLa cells None 34161081
10021416 MS HTP unambiguous human HeLa cells None 34161081
10022415 MS HTP unambiguous human HeLa cells None 34846842
10022577 MS HTP unambiguous human HeLa cells None 34846842
10022728 MS HTP unambiguous human HeLa cells None 34846842
10023040 MS HTP unambiguous human HeLa cells None 34846842
10023053 MS HTP unambiguous human HeLa cells None 34846842
10023232 MS HTP unambiguous human HeLa cells None 34846842
10023706 MS HTP unambiguous human THP1 cells None 32938750
10023707 MS HTP unambiguous human THP1 cells None 32938750
10025538 MS HTP unambiguous human HeLa cells None 35254053
10025562 MS HTP unambiguous human HeLa cells None 35254053
10025626 MS HTP unambiguous human HeLa cells None 35254053
10025730 MS HTP unambiguous human HeLa cells None 35254053
10025983 MS HTP unambiguous human HeLa cells None 35254053
10026184 MS HTP unambiguous human HeLa cells None 35254053
10026805 MS HTP unambiguous human HeLa cells None 35254053
10026806 MS HTP unambiguous human HeLa cells None 35254053
10027040 MS HTP unambiguous human HeLa cells None 35254053
10027800 MS HTP unambiguous human HeLa cells None 35254053
10028205 MS HTP unambiguous human SW480 cells None 35254053
10028206 MS HTP unambiguous human SW480 cells None 35254053
10028207 MS HTP unambiguous human SW480 cells None 35254053
10028614 MS HTP unambiguous human SW480 cells None 35254053
10029206 MS HTP unambiguous human SW620 cells None 35254053
10029728 MS HTP unambiguous human SW620 cells None 35254053
10029970 MS HTP unambiguous human SW620 cells None 35254053
10030527 MS HTP unambiguous human SW480 cells, SW620 cells SW620/SW480 None 0.003904135 35254053
10030528 MS HTP unambiguous human SW480 cells, SW620 cells SW620/SW480 None 0.020054797 35254053
10030803 MS HTP unambiguous human HeLa cell nucleus None 35289036
10031047 MS HTP unambiguous human HeLa cell nucleus None 35289036
10031908 MS HTP unambiguous human HeLa cell nucleus None 35289036
10031909 MS HTP unambiguous human HeLa cell nucleus None 35289036
10032470 MS HTP unambiguous human MCF-7 cells None 35513511
10033100 MS HTP unambiguous human Jurkat cells None 35705054
10036351 MS HTP unambiguous human HEK 293T cells None 30620550
10036352 MS HTP unambiguous human HEK 293T cells None 30620550
10036353 MS HTP unambiguous human HEK 293T cells None 30620550
10036354 MS HTP unambiguous human HEK 293T cells None 30620550
10036609 MS HTP unambiguous human HEK 293T cells None 30620550
10036814 MS HTP unambiguous human HepG2 cells None 30620550
10037073 MS HTP unambiguous human HepG2 cells None 30620550
10037278 MS HTP unambiguous human HEK 293T cells TMG/control None 30620550 Peptide quantification value was applied to each modification site
10037279 MS HTP unambiguous human HEK 293T cells TMG/control None 30620550 Peptide quantification value was applied to each modification site
10037435 MS HTP unambiguous human HepG2 cells orafenib sensitive/resistant None 30620550 Peptide quantification value was applied to each modification site
10039385 MS HTP unambiguous human PANC-1 cells None 39531497
10040704 MS HTP unambiguous human PANC-1 cells None 39531497
10040705 MS HTP unambiguous human PANC-1 cells None 39531497
10040898 MS HTP unambiguous human PANC-1 cells None 39531497
10042096 MS HTP unambiguous human PANC-1 cells None 39531497

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
3684 HFPSVIFAGVDSPGDVLDHTYQELFRAGGFVISDDK S 2264 MS HTP ambiguous human T cells 29351928
3685 HPVSTSENAR T 1098 MS HTP ambiguous human T cells 29351928
3686 HPVSTSENAR S 1099 MS HTP ambiguous human T cells 29351928
10001573 971 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10002821 967 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10002877 1150 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10002894 969 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10003383 1150 MS HTP unambiguous human colorectal cancer (CRC) cell lines 35254053
10003384 969 MS HTP unambiguous human colorectal cancer (CRC) cell lines 35254053
10005583 ETPLPVSLPSDK S 7 1150 MS HTP unambiguous human HEK 293T cells 37541260
10009411 ETPLPVSLPSDK S 7 1150 MS HTP unambiguous human brain 28657654
10010116 HPVSTSENAR S 4 1097 MS HTP unambiguous human T cells 29351928
10016217 VASYSGTVTQATFTR T 14 978 MS HTP unambiguous human MCF-7 cells 32574038
10016218 HPVSTSENAR S 4 1097 MS HTP unambiguous human MCF-7 cells 32574038
10016219 ETPLPVSLPSDK S 10 1153 MS HTP unambiguous human MCF-7 cells 32574038
10016572 VASYSGTVTQATFTR T 12 976 MS HTP unambiguous human MCF-7 cells 32574038
10016761 HPVSTSENAR T 5 1098 MS HTP unambiguous human MCF-7 cells 32574038
10021162 1595 MS HTP unambiguous human HeLa cells 34161081
10021366 1590 MS HTP unambiguous human HeLa cells 34161081
10021381 1556 MS HTP unambiguous human HeLa cells 34161081
10021416 978 MS HTP unambiguous human HeLa cells 34161081
10022415 VASYSGTVTQATFTR T 13 976 MS HTP unambiguous human HeLa cells 34846842
10022577 ETPLPVSLPSDK T 3 1145 MS HTP unambiguous human HeLa cells 34846842
10022728 ETPLPVSLPSDK S 8 1150 MS HTP unambiguous human HeLa cells 34846842
10023040 HPVSTSENAR S 5 1097 MS HTP unambiguous human HeLa cells 34846842
10023053 HPVSTSENAR T 6 1098 MS HTP unambiguous human HeLa cells 34846842
10023232 VASYSGTVTQATFTR T 15 978 MS HTP unambiguous human HeLa cells 34846842
10023706 ETPLPVSLPSDK S 7 1150 MS HTP unambiguous human THP1 cells 32938750
10023707 VASYSGTVTQATFTR S 5 969 MS HTP unambiguous human THP1 cells 32938750
10025538 VASYSGTVTQATFTR S 5 969 MS HTP unambiguous human HeLa cells 35254053
10025562 SLSDTLVSTTAPSGIVNVSVK T 10 1595 MS HTP unambiguous human HeLa cells 35254053
10025626 VASYSGTVTQATFTR S 3 967 MS HTP unambiguous human HeLa cells 35254053
10025730 ETPLPVSLPSDK S 7 1150 MS HTP unambiguous human HeLa cells 35254053
10025983 ETPLPVSLPSDK T 2 1145 MS HTP unambiguous human HeLa cells 35254053
10026184 VASYSGTVTQATFTR T 9 973 MS HTP unambiguous human HeLa cells 35254053
10026805 VASYSGTVTQATFTR T 7 971 MS HTP unambiguous human HeLa cells 35254053
10026806 HPVSTSENAR S 4 1097 MS HTP unambiguous human HeLa cells 35254053
10027040 SGNPLQPVSIENR S 9 1556 MS HTP unambiguous human HeLa cells 35254053
10027800 HPVSTSENAR T 5 1098 MS HTP unambiguous human HeLa cells 35254053
10028205 VASYSGTVTQATFTR S 5 969 MS HTP unambiguous human SW480 cells 35254053
10028206 ETPLPVSLPSDK S 7 1150 MS HTP unambiguous human SW480 cells 35254053
10028207 SLSDTLVSTTAPSGIVNVSVK T 10 1595 MS HTP unambiguous human SW480 cells 35254053
10028614 VASYSGTVTQATFTR S 3 967 MS HTP unambiguous human SW480 cells 35254053
10029206 ETPLPVSLPSDK S 7 1150 MS HTP unambiguous human SW620 cells 35254053
10029728 VASYSGTVTQATFTR S 5 969 MS HTP unambiguous human SW620 cells 35254053
10029970 HPVSTSENAR T 5 1098 MS HTP unambiguous human SW620 cells 35254053
10030527 S 1150 MS HTP unambiguous human SW480 cells, SW620 cells 35254053
10030528 S 969 MS HTP unambiguous human SW480 cells, SW620 cells 35254053
10030803 ETPLPVSLPSDK S 10 1153 MS HTP unambiguous human HeLa cell nucleus 35289036
10031047 ETPLPVSLPSDK T 2 1145 MS HTP unambiguous human HeLa cell nucleus 35289036
10031908 SSQNHLFPGDLK S 1 1613 MS HTP unambiguous human HeLa cell nucleus 35289036
10031909 TPVSEAR T 1 549 MS HTP unambiguous human HeLa cell nucleus 35289036
10032470 HPVSTSENAR S 1097 MS HTP unambiguous human MCF-7 cells 35513511
10033100 ETPLPVSLPSDK S 7 1150 MS HTP unambiguous human Jurkat cells 35705054
10036351 HPVSTSENAR S 1097 MS HTP unambiguous human HEK 293T cells 30620550
10036352 HPVSTSENAR T 1098 MS HTP unambiguous human HEK 293T cells 30620550
10036353 SGNPLQPVSIENR S 1556 MS HTP unambiguous human HEK 293T cells 30620550
10036354 SLSDTLVSTTAPSGIVNVSVK T 1595 MS HTP unambiguous human HEK 293T cells 30620550
10036609 VASYSGTVTQATFTR S 969 MS HTP unambiguous human HEK 293T cells 30620550
10036814 HPVSTSENAR 1098 MS HTP unambiguous human HepG2 cells 30620550
10037073 HPVSTSENAR 1097 MS HTP unambiguous human HepG2 cells 30620550
10037278 ETPLPVSLPSDK 1150 MS HTP unambiguous human HEK 293T cells 30620550 Peptide quantification value was applied to each modification site
10037279 ETPLPVSLPSDK 1153 MS HTP unambiguous human HEK 293T cells 30620550 Peptide quantification value was applied to each modification site
10037435 ETPLPVSLPSDK 1150 MS HTP unambiguous human HepG2 cells 30620550 Peptide quantification value was applied to each modification site
10039385 S 969 MS HTP unambiguous human PANC-1 cells 39531497
10040704 S 1150 MS HTP unambiguous human PANC-1 cells 39531497
10040705 T 1594 MS HTP unambiguous human PANC-1 cells 39531497
10040898 T 1595 MS HTP unambiguous human PANC-1 cells 39531497
10042096 S 967 MS HTP unambiguous human PANC-1 cells 39531497