| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein |
|---|---|---|---|---|
| 210 | SASQGALTSPSVSFSNHR | |||
| 10856 | SASQGALTSPSVSFSNHR | |||
| 10001032 | SASQGALTSPSVSFSNHR | S | 1 | 474 |
| 10002721 | 474 | |||
| 10005292 | SASQGALTSPSVSFSNHR | S | 1 | 475 |
| 10011531 | QERLEDSVLMKYCPRSASQGALTSPSVSFSN | S | 474 | |
| 10013204 | KGKSTGSLLTPTR | T | 1747 | |
| 10013205 | PTATGTFGVR | T | 1143 | |
| 10013206 | AASQSTTDYNQVVPNR | S | 420 | |
| 10013207 | AASQSTTDYNQVVPNR | T | 421 | |
| 10015341 | SASQGALTSPSVSFSNHR | S | 1 | 475 |
| 10019480 | SASQGALTSPSVSFSNHR | S | 1 | 474 |
| 10023696 | SASQGALTSPSVSFSNHR | S | 1 | 475 |
| 10025506 | SASQGALTSPSVSFSNHR | S | 1 | 474 |
| 10032459 | SASQGALTSPSVSFSNHR | S | 474 |
| ID | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Condition | log2Ratio | P Value | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|
| 210 | MS | HTP | ambiguous | human | HeLa cells | ionizing radiation/control | None | 0.001028128 | 30379171 | |
| 10856 | MS | HTP | ambiguous | human | HeLa cells | None | 30379171 | |||
| 10001032 | MS | HTP | unambiguous | human | HeLa cells | 20 uM GalNAz/200 uM GalNAz | None | 30059200 | ||
| 10002721 | MS | HTP | unambiguous | human | HeLa cells | Mitotic exit/Early mitosis | None | 34161081 | The p value was -log10p in original paper. | |
| 10005292 | MS | HTP | unambiguous | human | HEK 293T cells | glucose-deprived/glucose-sufficient | None | 37541260 | ||
| 10011531 | MS | HTP | unambiguous | human | HeLa cells | None | 30059200 | This position assigment in the protein sequence seems problematic, which could not be curated | ||
| 10013204 | MS | HTP | unambiguous | human | HeLa cells | None | 30379171 | This position assigment in the protein sequence seems problematic, which could not be curated | ||
| 10013205 | MS | HTP | unambiguous | human | HeLa cells | None | 30379171 | This position assigment in the protein sequence seems problematic, which could not be curated | ||
| 10013206 | MS | HTP | unambiguous | human | HeLa cells | None | 30379171 | This position assigment in the protein sequence seems problematic, which could not be curated | ||
| 10013207 | MS | HTP | unambiguous | human | HeLa cells | None | 30379171 | This position assigment in the protein sequence seems problematic, which could not be curated | ||
| 10015341 | MS | HTP | unambiguous | human | HeLa cells | None | 31492838 | This site was described as S474 of the protein sequence in the original paper | ||
| 10019480 | MS | HTP | unambiguous | human | Hela cells | None | 29237092 | |||
| 10023696 | MS | HTP | unambiguous | human | THP1 cells | None | 32938750 | |||
| 10025506 | MS | HTP | unambiguous | human | HeLa cells | None | 35254053 | |||
| 10032459 | MS | HTP | unambiguous | human | MCF-7 cells | None | 35513511 |
| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 210 | SASQGALTSPSVSFSNHR | MS | HTP | ambiguous | human | HeLa cells | 30379171 | ||||
| 10856 | SASQGALTSPSVSFSNHR | MS | HTP | ambiguous | human | HeLa cells | 30379171 | ||||
| 10001032 | SASQGALTSPSVSFSNHR | S | 1 | 474 | MS | HTP | unambiguous | human | HeLa cells | 30059200 | |
| 10002721 | 474 | MS | HTP | unambiguous | human | HeLa cells | 34161081 | The p value was -log10p in original paper. | |||
| 10005292 | SASQGALTSPSVSFSNHR | S | 1 | 475 | MS | HTP | unambiguous | human | HEK 293T cells | 37541260 | |
| 10011531 | QERLEDSVLMKYCPRSASQGALTSPSVSFSN | S | 474 | MS | HTP | unambiguous | human | HeLa cells | 30059200 | This position assigment in the protein sequence seems problematic, which could not be curated | |
| 10013204 | KGKSTGSLLTPTR | T | 1747 | MS | HTP | unambiguous | human | HeLa cells | 30379171 | This position assigment in the protein sequence seems problematic, which could not be curated | |
| 10013205 | PTATGTFGVR | T | 1143 | MS | HTP | unambiguous | human | HeLa cells | 30379171 | This position assigment in the protein sequence seems problematic, which could not be curated | |
| 10013206 | AASQSTTDYNQVVPNR | S | 420 | MS | HTP | unambiguous | human | HeLa cells | 30379171 | This position assigment in the protein sequence seems problematic, which could not be curated | |
| 10013207 | AASQSTTDYNQVVPNR | T | 421 | MS | HTP | unambiguous | human | HeLa cells | 30379171 | This position assigment in the protein sequence seems problematic, which could not be curated | |
| 10015341 | SASQGALTSPSVSFSNHR | S | 1 | 475 | MS | HTP | unambiguous | human | HeLa cells | 31492838 | This site was described as S474 of the protein sequence in the original paper |
| 10019480 | SASQGALTSPSVSFSNHR | S | 1 | 474 | MS | HTP | unambiguous | human | Hela cells | 29237092 | |
| 10023696 | SASQGALTSPSVSFSNHR | S | 1 | 475 | MS | HTP | unambiguous | human | THP1 cells | 32938750 | |
| 10025506 | SASQGALTSPSVSFSNHR | S | 1 | 474 | MS | HTP | unambiguous | human | HeLa cells | 35254053 | |
| 10032459 | SASQGALTSPSVSFSNHR | S | 474 | MS | HTP | unambiguous | human | MCF-7 cells | 35513511 |