Details for Accession #: Q5H9F3


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
3599 AEGDPGVSWDFYSSSVLEEK S 1556
3600 PTSTQVLPVGWSPYHQASLLSIGISSAGQLTPSQGAPIR T 824
3601 PTSTQVLPVGWSPYHQASLLSIGISSAGQLTPSQGAPIR S 834
3602 SIGISSAGQLTPSQGAPIRPTSVVSEF S 855
10001030 TPPMPVLTPVHTSSK T 12 652
10001661 652
10002696 652
10002941 652
10003373 641
10005526 LPASDSAEASNSR S 4 127
10011523 NQRKTPPMPVLTPVHTSSKALLSTVLSRSQR T 652
10013169 ELILDVVPSSRR S 1028
10013170 ELILDVVPSSRR S 1029
10023671 TPPMPVLTPVHTSSK T 12 652
10025809 LPASDSAEASNSR S 4 127
10025974 LPASDSAEASNSR S 12 135
10025975 KTPPMPVLTPVHTSSK T 13 652
10026353 TPPMPVLTPVHTSSK T 1 641
10028191 KTPPMPVLTPVHTSSK T 2 641
10028192 TPPMPVLTPVHTSSK T 12 652
10028605 KTPPMPVLTPVHTSSK T 13 652
10029190 KTPPMPVLTPVHTSSK T 13 652
10029714 KTPPMPVLTPVHTSSK T 2 641
10030115 T 652
10030517 T 641
10031892 TPPMPVLTPVHTSSK T 12 652
10033942 KTPPMPVLTPVHTSSK T 13 652
10036297 LPASDSAEASNSR S 127
10036580 LPASDSAEASNSR S 135
10036784 LPASDSAEASNSR 127
10038889 T 652
10039166 S 653
10039214 T 641
10039670 T 513
10039671 S 501
10039889 Y 504
10040652 T 652
10040856 S 706
10040865 T 648
10040866 T 641
10041363 T 716
10041364 T 563
10041507 T 677
10041609 S 514
10042022 S 663
10042093 S 116
10045057 NSTALISTIPGTYVGVANPVPASLLLNK T 3 707
10045819 NSTALISTIPGTYVGVANPVPASLLLNK T 8 712

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
3599 MS HTP ambiguous human T cells None 29351928
3600 MS HTP ambiguous human T cells None 29351928
3601 MS HTP ambiguous human T cells None 29351928
3602 MS HTP ambiguous human T cells None 29351928
10001030 MS HTP unambiguous human HeLa cells 20 uM GalNAz/200 uM GalNAz None 30059200
10001661 MS HTP unambiguous human HeLa cells Interphase/Mitosis None 0.005959 34161081 The p value was -log10p in original paper.
10002696 MS HTP unambiguous human HeLa cells Mitotic exit/Early mitosis None 34161081 The p value was -log10p in original paper.
10002941 MS HTP unambiguous human colorectal cancer (CRC) cell lines SW620 cells/SW480 cells None 0.005539394 35254053
10003373 MS HTP unambiguous human colorectal cancer (CRC) cell lines SW620 cells/SW480 cells None 0.056219972 35254053
10005526 MS HTP unambiguous human HEK 293T cells glucose-deprived/glucose-sufficient None 37541260
10011523 MS HTP unambiguous human HeLa cells None 30059200
10013169 MS HTP unambiguous human HeLa cells None 30379171
10013170 MS HTP unambiguous human HeLa cells None 30379171
10023671 MS HTP unambiguous human THP1 cells None 32938750
10025809 MS HTP unambiguous human HeLa cells None 35254053
10025974 MS HTP unambiguous human HeLa cells None 35254053
10025975 MS HTP unambiguous human HeLa cells None 35254053
10026353 MS HTP unambiguous human HeLa cells None 35254053
10028191 MS HTP unambiguous human SW480 cells None 35254053
10028192 MS HTP unambiguous human SW480 cells None 35254053
10028605 MS HTP unambiguous human SW480 cells None 35254053
10029190 MS HTP unambiguous human SW620 cells None 35254053
10029714 MS HTP unambiguous human SW620 cells None 35254053
10030115 MS HTP unambiguous human SW480 cells, SW620 cells SW620/SW480 None 0.005539394 35254053
10030517 MS HTP unambiguous human SW480 cells, SW620 cells SW620/SW480 None 0.056219972 35254053
10031892 MS HTP unambiguous human HeLa cell nucleus None 35289036
10033942 MS HTP unambiguous human HEK 293T cells glucose-deprived/glucose-sufficient None 37541260
10036297 MS HTP unambiguous human HEK 293T cells None 30620550
10036580 MS HTP unambiguous human HEK 293T cells None 30620550
10036784 MS HTP unambiguous human HepG2 cells None 30620550
10038889 MS HTP unambiguous human PANC-1 cells None 39302247
10039166 MS HTP unambiguous human PANC-1 cells None 39302247
10039214 MS HTP unambiguous human PANC-1 cells None 39302247
10039670 MS HTP unambiguous human PANC-1 cells None 39531497
10039671 MS HTP unambiguous human PANC-1 cells None 39531497
10039889 MS HTP unambiguous human PANC-1 cells None 39531497
10040652 MS HTP unambiguous human PANC-1 cells None 39531497
10040856 MS HTP unambiguous human PANC-1 cells None 39531497
10040865 MS HTP unambiguous human PANC-1 cells None 39531497
10040866 MS HTP unambiguous human PANC-1 cells None 39531497
10041363 MS HTP unambiguous human PANC-1 cells None 39531497
10041364 MS HTP unambiguous human PANC-1 cells None 39531497
10041507 MS HTP unambiguous human PANC-1 cells None 39531497
10041609 MS HTP unambiguous human PANC-1 cells None 39531497
10042022 MS HTP unambiguous human PANC-1 cells None 39531497
10042093 MS HTP unambiguous human PANC-1 cells None 39531497
10045057 MS HTP unambiguous human HeLa cells: nucleus None 39534244
10045819 MS HTP unambiguous human HeLa cells: nucleus None 39534244

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
3599 AEGDPGVSWDFYSSSVLEEK S 1556 MS HTP ambiguous human T cells 29351928
3600 PTSTQVLPVGWSPYHQASLLSIGISSAGQLTPSQGAPIR T 824 MS HTP ambiguous human T cells 29351928
3601 PTSTQVLPVGWSPYHQASLLSIGISSAGQLTPSQGAPIR S 834 MS HTP ambiguous human T cells 29351928
3602 SIGISSAGQLTPSQGAPIRPTSVVSEF S 855 MS HTP ambiguous human T cells 29351928
10001030 TPPMPVLTPVHTSSK T 12 652 MS HTP unambiguous human HeLa cells 30059200
10001661 652 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10002696 652 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10002941 652 MS HTP unambiguous human colorectal cancer (CRC) cell lines 35254053
10003373 641 MS HTP unambiguous human colorectal cancer (CRC) cell lines 35254053
10005526 LPASDSAEASNSR S 4 127 MS HTP unambiguous human HEK 293T cells 37541260
10011523 NQRKTPPMPVLTPVHTSSKALLSTVLSRSQR T 652 MS HTP unambiguous human HeLa cells 30059200
10013169 ELILDVVPSSRR S 1028 MS HTP unambiguous human HeLa cells 30379171
10013170 ELILDVVPSSRR S 1029 MS HTP unambiguous human HeLa cells 30379171
10023671 TPPMPVLTPVHTSSK T 12 652 MS HTP unambiguous human THP1 cells 32938750
10025809 LPASDSAEASNSR S 4 127 MS HTP unambiguous human HeLa cells 35254053
10025974 LPASDSAEASNSR S 12 135 MS HTP unambiguous human HeLa cells 35254053
10025975 KTPPMPVLTPVHTSSK T 13 652 MS HTP unambiguous human HeLa cells 35254053
10026353 TPPMPVLTPVHTSSK T 1 641 MS HTP unambiguous human HeLa cells 35254053
10028191 KTPPMPVLTPVHTSSK T 2 641 MS HTP unambiguous human SW480 cells 35254053
10028192 TPPMPVLTPVHTSSK T 12 652 MS HTP unambiguous human SW480 cells 35254053
10028605 KTPPMPVLTPVHTSSK T 13 652 MS HTP unambiguous human SW480 cells 35254053
10029190 KTPPMPVLTPVHTSSK T 13 652 MS HTP unambiguous human SW620 cells 35254053
10029714 KTPPMPVLTPVHTSSK T 2 641 MS HTP unambiguous human SW620 cells 35254053
10030115 T 652 MS HTP unambiguous human SW480 cells, SW620 cells 35254053
10030517 T 641 MS HTP unambiguous human SW480 cells, SW620 cells 35254053
10031892 TPPMPVLTPVHTSSK T 12 652 MS HTP unambiguous human HeLa cell nucleus 35289036
10033942 KTPPMPVLTPVHTSSK T 13 652 MS HTP unambiguous human HEK 293T cells 37541260
10036297 LPASDSAEASNSR S 127 MS HTP unambiguous human HEK 293T cells 30620550
10036580 LPASDSAEASNSR S 135 MS HTP unambiguous human HEK 293T cells 30620550
10036784 LPASDSAEASNSR 127 MS HTP unambiguous human HepG2 cells 30620550
10038889 T 652 MS HTP unambiguous human PANC-1 cells 39302247
10039166 S 653 MS HTP unambiguous human PANC-1 cells 39302247
10039214 T 641 MS HTP unambiguous human PANC-1 cells 39302247
10039670 T 513 MS HTP unambiguous human PANC-1 cells 39531497
10039671 S 501 MS HTP unambiguous human PANC-1 cells 39531497
10039889 Y 504 MS HTP unambiguous human PANC-1 cells 39531497
10040652 T 652 MS HTP unambiguous human PANC-1 cells 39531497
10040856 S 706 MS HTP unambiguous human PANC-1 cells 39531497
10040865 T 648 MS HTP unambiguous human PANC-1 cells 39531497
10040866 T 641 MS HTP unambiguous human PANC-1 cells 39531497
10041363 T 716 MS HTP unambiguous human PANC-1 cells 39531497
10041364 T 563 MS HTP unambiguous human PANC-1 cells 39531497
10041507 T 677 MS HTP unambiguous human PANC-1 cells 39531497
10041609 S 514 MS HTP unambiguous human PANC-1 cells 39531497
10042022 S 663 MS HTP unambiguous human PANC-1 cells 39531497
10042093 S 116 MS HTP unambiguous human PANC-1 cells 39531497
10045057 NSTALISTIPGTYVGVANPVPASLLLNK T 3 707 MS HTP unambiguous human HeLa cells: nucleus 39534244
10045819 NSTALISTIPGTYVGVANPVPASLLLNK T 8 712 MS HTP unambiguous human HeLa cells: nucleus 39534244