| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein |
|---|---|---|---|---|
| 898 | LPTITVTTTSVTSK | T | 7 | 220 |
| 998 | VPNVVTAPTSKVPTVVTVPTSK | T | 14 | 357 |
| 999 | VPNVVTAPTSKVPTVVTVPTSK | S | 21 | 364 |
| 1038 | VPNVVTAPTSKVPTVVTVPTSK | T | 9 | 352 |
| 1072 | VPNVVTAPTSKVPTVVTVPTSK | S | 10 | 353 |
| 1073 | VPNVVTAPTSKVPTVVTVPTSK | T | 20 | 363 |
| 6336 | LPTITVTTTSVTSK | S | 10 | 337 |
| 6397 | FFQTPPSAPAPASAPAPAPTSK | T | 4 | 428 |
| 6407 | FFQTPPSAPAPASAPAPAPTSK | T | 20 | 444 |
| 6413 | VPTVVTVPTSK | T | 9 | 455 |
| 6420 | VPNVVTAPTSKVPTVVTVPTSK | T | 6 | 463 |
| 6423 | VPNVVTAPTSK | T | 9 | 466 |
| 6428 | VPTVVTVPTSKVPTVVSAPTSK | T | 9 | 477 |
| 6432 | VPTVVSAPTSK | S | 6 | 485 |
| 6434 | VPTVVSAPTSK | T | 9 | 488 |
| 6437 | VPTVVSAPTSKVPTVVSAPTSK | T | 14 | 493 |
| 6439 | VPTVVSAPTSKVPTVVNSTNSR | S | 6 | 496 |
| 6451 | VTTVVNAPTSK | T | 3 | 515 |
| 6454 | VTTVVNAPTSKVPTVVSATNGR | T | 9 | 521 |
| 6578 | ASSSSDSSVHITLTSIQHK | S | 2 | 733 |
| 6579 | KASSSSDSSVHITLTSIQHK | S | 5 | 735 |
| 6580 | ASSSSDSSVHITLTSIQHK | S | 5 | 736 |
| 9555 | LPTITVTTTSVTSK | T | 7 | 334 |
| 9556 | LPTITVTTTSVTSK | T | 8 | 335 |
| 9557 | VPTVVTVPTSK | T | 9 | 455 |
| 9558 | VPTVVTVPTSK | S | 10 | 456 |
| 10003795 | S | 456 | ||
| 10003806 | S | 322 | ||
| 10003922 | S | 522 | ||
| 10003968 | S | 340 | ||
| 10003971 | S | 489 | ||
| 10003989 | T | 336 | ||
| 10004040 | S | 467 | ||
| 10004181 | T | 428 | ||
| 10004559 | T | 308 | ||
| 10005255 | T | 471 | ||
| 10007250 | VPTVVSAPTSKVPTVVNSTNSR | S | 10 | 500 |
| 10007251 | LPTITVTTTSVTSK | T | 8 | 221 |
| 10007252 | GFVQTELKPPSTSQVHVGSSAGPK | S | 19 | 322 |
| 10007667 | VTTVVNAPTSK | S | 10 | 408 |
| 10008246 | VPTVVTVPTSKVPTVVSAPTSK | S | 10 | 478 |
| 10008247 | VPTVVTVPTSK | S | 10 | 456 |
| 10010673 | GFVQTELKPPSTSQVHVGSSAGPK | S | 314 | |
| 10010674 | GFVQTELKPPSTSQVHVGSSAGPK | S | 323 | |
| 10010675 | VPTVVTVPTSK | S | 456 | |
| 10012041 | VPTVVTVPTSK | S | 10 | 456 |
| 10017022 | GFVQTELKPPSTSQVHVGSSAGPK | S | 19 | 322 |
| 10017023 | GFVQTELKPPSTSQVHVGSSAGPK | S | 20 | 323 |
| 10017024 | LPTITVTTTSVTSK | T | 3 | 330 |
| 10017025 | LPTITVTTTSVTSK | T | 5 | 332 |
| 10017026 | LPTITVTTTSVTSK | T | 7 | 334 |
| 10017027 | LPTITVTTTSVTSK | T | 8 | 335 |
| 10017028 | LPTITVTTTSVTSK | T | 9 | 336 |
| 10017029 | LPTITVTTTSVTSK | S | 13 | 340 |
| 10017030 | ALTHVTNSSPIGWSSPAQSSPANFNSRPVVSPSAR | T | 6 | 347 |
| 10017031 | EKFFQTPPSAPAPASAPAPAPTSK | S | 15 | 437 |
| 10017032 | EKFFQTPPSAPAPASAPAPAPTSK | S | 23 | 445 |
| 10017033 | VPTVVTVPTSKVPNVVTAPTSK | S | 10 | 456 |
| 10017034 | VPNVVTAPTSK | S | 10 | 467 |
| 10017035 | VPTVVTVPTSKVPTVVSAPTSK | T | 3 | 471 |
| 10017036 | VPTVVTVPTSKVPTVVSAPTSK | S | 10 | 478 |
| 10017037 | VPTVVSAPTSKVPTVVSAPTSK | T | 3 | 482 |
| 10017038 | VPTVVSAPTSK | S | 10 | 489 |
| 10017039 | VPTVVSAPTSKVPTVVNSTNSR | S | 10 | 500 |
| 10017040 | VTTVVNAPTSK | T | 2 | 514 |
| 10017041 | VTTVVNAPTSK | S | 10 | 522 |
| 10017042 | KASSSSDSSVHITLTSIQHK | S | 4 | 734 |
| 10018327 | LPTITVTTTSVTSK | T | 9 | 336 |
| 10018328 | VPNVVTAPTSK | S | 10 | 467 |
| 10018329 | VPTVVSAPTSK | S | 10 | 489 |
| ID | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Condition | log2Ratio | P Value | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|
| 898 | MS | HTP | ambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this position assignment in the protein sequence seems problematic, which has not been curated | |||
| 998 | MS | HTP | ambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this position assignment in the protein sequence seems problematic, which has not been curated | |||
| 999 | MS | HTP | ambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this position assignment in the protein sequence seems problematic, which has not been curated | |||
| 1038 | MS | HTP | ambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this position assignment in the protein sequence seems problematic, which has not been curated | |||
| 1072 | MS | HTP | ambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this position assignment in the protein sequence seems problematic, which has not been curated | |||
| 1073 | MS | HTP | ambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34; this position assignment in the protein sequence seems problematic, which has not been curated assigned | |||
| 6336 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 6397 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 6407 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 6413 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 6420 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 6423 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 6428 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 6432 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 6434 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 6437 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 6439 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 6451 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 6454 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 6578 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 6579 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 6580 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 9555 | MS | HTP | ambiguous | mouse | hippocampus | 32848054 | ||||
| 9556 | MS | HTP | ambiguous | mouse | hippocampus | 32848054 | ||||
| 9557 | MS | HTP | ambiguous | mouse | hippocampus | 32848054 | ||||
| 9558 | MS | HTP | ambiguous | mouse | hippocampus | 32848054 | ||||
| 10003795 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | ||||
| 10003806 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | ||||
| 10003922 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | ||||
| 10003968 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | ||||
| 10003971 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | ||||
| 10003989 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | ||||
| 10004040 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | ||||
| 10004181 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | ||||
| 10004559 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | ||||
| 10005255 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | control/RA-induced differentiated | 1.182692298 | 5.86E-04 | 36852467 | |
| 10007250 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; the site was desribed as 'S386' in the original paper | |||
| 10007251 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned | |||
| 10007252 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; the site was desribed as 'S208' in the original paper | |||
| 10007667 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this position assignment in the protein sequence seems problematic, which can not be curated | |||
| 10008246 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this site was described in position 364 in the protein sequence in the original paper | |||
| 10008247 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this site was described in position 342 in the protein sequence in the original paper | |||
| 10010673 | MS | HTP | unambiguous | mouse | C2C12 cells | 30016717 | ||||
| 10010674 | MS | HTP | unambiguous | mouse | C2C12 cells | 30016717 | ||||
| 10010675 | MS | HTP | unambiguous | mouse | C2C12 cells | 30016717 | ||||
| 10012041 | MS | HTP | unambiguous | mouse | placenta | 30059200 | ||||
| 10017022 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017023 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017024 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017025 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017026 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017027 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017028 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017029 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017030 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017031 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017032 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017033 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017034 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017035 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017036 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017037 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017038 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017039 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017040 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017041 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10017042 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | ||||
| 10018327 | MS | HTP | unambiguous | mouse | hippocampus | 32848054 | ||||
| 10018328 | MS | HTP | unambiguous | mouse | hippocampus | 32848054 | ||||
| 10018329 | MS | HTP | unambiguous | mouse | hippocampus | 32848054 |
| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 898 | LPTITVTTTSVTSK | T | 7 | 220 | MS | HTP | ambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this position assignment in the protein sequence seems problematic, which has not been curated |
| 998 | VPNVVTAPTSKVPTVVTVPTSK | T | 14 | 357 | MS | HTP | ambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this position assignment in the protein sequence seems problematic, which has not been curated |
| 999 | VPNVVTAPTSKVPTVVTVPTSK | S | 21 | 364 | MS | HTP | ambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this position assignment in the protein sequence seems problematic, which has not been curated |
| 1038 | VPNVVTAPTSKVPTVVTVPTSK | T | 9 | 352 | MS | HTP | ambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this position assignment in the protein sequence seems problematic, which has not been curated |
| 1072 | VPNVVTAPTSKVPTVVTVPTSK | S | 10 | 353 | MS | HTP | ambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this position assignment in the protein sequence seems problematic, which has not been curated |
| 1073 | VPNVVTAPTSKVPTVVTVPTSK | T | 20 | 363 | MS | HTP | ambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34; this position assignment in the protein sequence seems problematic, which has not been curated assigned |
| 6336 | LPTITVTTTSVTSK | S | 10 | 337 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 6397 | FFQTPPSAPAPASAPAPAPTSK | T | 4 | 428 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 6407 | FFQTPPSAPAPASAPAPAPTSK | T | 20 | 444 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 6413 | VPTVVTVPTSK | T | 9 | 455 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 6420 | VPNVVTAPTSKVPTVVTVPTSK | T | 6 | 463 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 6423 | VPNVVTAPTSK | T | 9 | 466 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 6428 | VPTVVTVPTSKVPTVVSAPTSK | T | 9 | 477 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 6432 | VPTVVSAPTSK | S | 6 | 485 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 6434 | VPTVVSAPTSK | T | 9 | 488 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 6437 | VPTVVSAPTSKVPTVVSAPTSK | T | 14 | 493 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 6439 | VPTVVSAPTSKVPTVVNSTNSR | S | 6 | 496 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 6451 | VTTVVNAPTSK | T | 3 | 515 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 6454 | VTTVVNAPTSKVPTVVSATNGR | T | 9 | 521 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 6578 | ASSSSDSSVHITLTSIQHK | S | 2 | 733 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 6579 | KASSSSDSSVHITLTSIQHK | S | 5 | 735 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 6580 | ASSSSDSSVHITLTSIQHK | S | 5 | 736 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 9555 | LPTITVTTTSVTSK | T | 7 | 334 | MS | HTP | ambiguous | mouse | hippocampus | 32848054 | |
| 9556 | LPTITVTTTSVTSK | T | 8 | 335 | MS | HTP | ambiguous | mouse | hippocampus | 32848054 | |
| 9557 | VPTVVTVPTSK | T | 9 | 455 | MS | HTP | ambiguous | mouse | hippocampus | 32848054 | |
| 9558 | VPTVVTVPTSK | S | 10 | 456 | MS | HTP | ambiguous | mouse | hippocampus | 32848054 | |
| 10003795 | S | 456 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
| 10003806 | S | 322 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
| 10003922 | S | 522 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
| 10003968 | S | 340 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
| 10003971 | S | 489 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
| 10003989 | T | 336 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
| 10004040 | S | 467 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
| 10004181 | T | 428 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
| 10004559 | T | 308 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
| 10005255 | T | 471 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
| 10007250 | VPTVVSAPTSKVPTVVNSTNSR | S | 10 | 500 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; the site was desribed as 'S386' in the original paper |
| 10007251 | LPTITVTTTSVTSK | T | 8 | 221 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned |
| 10007252 | GFVQTELKPPSTSQVHVGSSAGPK | S | 19 | 322 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; the site was desribed as 'S208' in the original paper |
| 10007667 | VTTVVNAPTSK | S | 10 | 408 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this position assignment in the protein sequence seems problematic, which can not be curated |
| 10008246 | VPTVVTVPTSKVPTVVSAPTSK | S | 10 | 478 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this site was described in position 364 in the protein sequence in the original paper |
| 10008247 | VPTVVTVPTSK | S | 10 | 456 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | The original accession E9PY24 is obsolete in UniProt, with the new accession Q3TN34 assigned; this site was described in position 342 in the protein sequence in the original paper |
| 10010673 | GFVQTELKPPSTSQVHVGSSAGPK | S | 314 | MS | HTP | unambiguous | mouse | C2C12 cells | 30016717 | ||
| 10010674 | GFVQTELKPPSTSQVHVGSSAGPK | S | 323 | MS | HTP | unambiguous | mouse | C2C12 cells | 30016717 | ||
| 10010675 | VPTVVTVPTSK | S | 456 | MS | HTP | unambiguous | mouse | C2C12 cells | 30016717 | ||
| 10012041 | VPTVVTVPTSK | S | 10 | 456 | MS | HTP | unambiguous | mouse | placenta | 30059200 | |
| 10017022 | GFVQTELKPPSTSQVHVGSSAGPK | S | 19 | 322 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017023 | GFVQTELKPPSTSQVHVGSSAGPK | S | 20 | 323 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017024 | LPTITVTTTSVTSK | T | 3 | 330 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017025 | LPTITVTTTSVTSK | T | 5 | 332 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017026 | LPTITVTTTSVTSK | T | 7 | 334 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017027 | LPTITVTTTSVTSK | T | 8 | 335 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017028 | LPTITVTTTSVTSK | T | 9 | 336 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017029 | LPTITVTTTSVTSK | S | 13 | 340 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017030 | ALTHVTNSSPIGWSSPAQSSPANFNSRPVVSPSAR | T | 6 | 347 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017031 | EKFFQTPPSAPAPASAPAPAPTSK | S | 15 | 437 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017032 | EKFFQTPPSAPAPASAPAPAPTSK | S | 23 | 445 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017033 | VPTVVTVPTSKVPNVVTAPTSK | S | 10 | 456 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017034 | VPNVVTAPTSK | S | 10 | 467 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017035 | VPTVVTVPTSKVPTVVSAPTSK | T | 3 | 471 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017036 | VPTVVTVPTSKVPTVVSAPTSK | S | 10 | 478 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017037 | VPTVVSAPTSKVPTVVSAPTSK | T | 3 | 482 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017038 | VPTVVSAPTSK | S | 10 | 489 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017039 | VPTVVSAPTSKVPTVVNSTNSR | S | 10 | 500 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017040 | VTTVVNAPTSK | T | 2 | 514 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017041 | VTTVVNAPTSK | S | 10 | 522 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10017042 | KASSSSDSSVHITLTSIQHK | S | 4 | 734 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
| 10018327 | LPTITVTTTSVTSK | T | 9 | 336 | MS | HTP | unambiguous | mouse | hippocampus | 32848054 | |
| 10018328 | VPNVVTAPTSK | S | 10 | 467 | MS | HTP | unambiguous | mouse | hippocampus | 32848054 | |
| 10018329 | VPTVVSAPTSK | S | 10 | 489 | MS | HTP | unambiguous | mouse | hippocampus | 32848054 |