ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein |
---|---|---|---|---|
1416 | STTPTSSPFR | S | 1 | 2632 |
6837 | LPSAQTSNGTDFVAAGK | T | 6 | 1917 |
6838 | SMPTSQSHGSLTAELWDSK | S | 1 | 1929 |
6839 | SMPTSQSHGSLTAELWDSK | T | 4 | 1932 |
6840 | SMPTSQSHGSLTAELWDSK | S | 7 | 1935 |
6858 | ESVTDYTTPSSSLPNTVATNNAK | S | 2 | 2138 |
6860 | ESVTDYTTPSSSLPNTVATNNAK | T | 4 | 2140 |
6861 | ESVTDYTTPSSSLPNTVATNNAK | T | 7 | 2143 |
6862 | ESVTDYTTPSSSLPNTVATNNAK | T | 8 | 2144 |
6863 | ESVTDYTTPSSSLPNTVATNNAK | S | 10 | 2146 |
6864 | ESVTDYTTPSSSLPNTVATNNAK | S | 11 | 2147 |
6865 | ESVTDYTTPSSSLPNTVATNNAK | S | 12 | 2148 |
6873 | ETIQQSSSLTSVPPTTFSLTFK | S | 6 | 2185 |
6875 | RETIQQSSSLTSVPPTTFSLTFK | S | 9 | 2187 |
6877 | RETIQQSSSLTSVPPTTFSLTFK | T | 11 | 2189 |
6879 | RETIQQSSSLTSVPPTTFSLTFK | T | 17 | 2195 |
6881 | STTTSDPPNICK | S | 1 | 2282 |
6882 | STTTSDPPNICK | T | 3 | 2284 |
6883 | STTTSDPPNICK | T | 4 | 2285 |
6904 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 8 | 2428 |
6905 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 9 | 2429 |
6906 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 11 | 2431 |
6907 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 14 | 2434 |
6908 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 18 | 2438 |
6909 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | T | 20 | 2440 |
6913 | GLIPAGTQHSMMATTGK | S | 10 | 2599 |
6916 | STTPTSSPFR | T | 2 | 2633 |
9548 | ESVTDYTTPSSSLPNTVATNNAK | S | 11 | 2147 |
9549 | RETIQQSSSLTSVPPTTFSLTFK | T | 16 | 2194 |
9550 | RETIQQSSSLTSVPPTTFSLTFK | S | 19 | 2197 |
9551 | ETIQQSSSLTSVPPTTFSLTFK | T | 20 | 2199 |
9552 | STTTSDPPNICK | T | 2 | 2283 |
9553 | STTTSDPPNICK | T | 3 | 2284 |
9554 | ATSTSPNSQSSK | T | 4 | 2645 |
10001282 | RETIQQSSSLTSVPPTTFSLTFK | T | 17 | 2195 |
10003596 | T | 2173 | ||
10003764 | T | 2195 | ||
10003797 | S | 2190 | ||
10003835 | S | 1918 | ||
10003941 | S | 2197 | ||
10004017 | S | 882 | ||
10004057 | S | 2431 | ||
10004129 | S | 2148 | ||
10004180 | T | 1932 | ||
10004399 | S | 2585 | ||
10004400 | S | 1933 | ||
10004401 | S | 878 | ||
10004402 | T | 2194 | ||
10004403 | S | 2429 | ||
10004593 | S | 2632 | ||
10004786 | S | 1929 | ||
10004822 | T | 2181 | ||
10004868 | S | 2421 | ||
10004987 | S | 1929 | ||
10004988 | S | 2421 | ||
10004989 | T | 2181 | ||
10004990 | T | 2163 | ||
10006777 | TSVPPTTFSLTFK | T | 2177 | |
10006961 | SIQPYRSQPAFMQ | S | 2403 | |
10007215 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 1 | 2421 |
10007364 | SMPTSQSHGSLTAELWDSK | S | 5 | 1933 |
10007634 | GLIPAGTQHSMMATTGK | T | 7 | 2596 |
10012381 | RETIQQSSSLTSVPPTTFSLTFK | T | 17 | 2195 |
10017012 | LPSAQTSNGTDFVAAGK | S | 7 | 1918 |
10017013 | SMPTSQSHGSLTAELWDSK | S | 5 | 1933 |
10017014 | RETIQQSSSLTSVPPTTFSLTFK | S | 12 | 2190 |
10017015 | RETIQQSSSLTSVPPTTFSLTFK | T | 16 | 2194 |
10017016 | STTTSDPPNICK | T | 2 | 2283 |
10017017 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 1 | 2421 |
10017018 | GLIPAGTQHSMMATTGK | T | 7 | 2596 |
10017019 | STTPTSSPFR | S | 1 | 2632 |
10017020 | STTPTSSPFR | T | 3 | 2634 |
10017021 | STTPTSSPFR | S | 6 | 2637 |
10018323 | ESVTDYTTPSSSLPNTVATNNAK | S | 12 | 2148 |
10018324 | ETIQQSSSLTSVPPTTFSLTFK | T | 16 | 2195 |
10018325 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 1 | 2421 |
10018326 | ATSTSPNSQSSK | S | 3 | 2644 |
10019742 | RETIQQSSSLTSVPPTTFSLTFK | S | 2190 | |
10019814 | RETIQQSSSLTSVPPTTFSLTFK | T | 2195 | |
10021648 | RETIQQSSSLTSVPPTTFSLTFK | T | 16 | 2194 |
10021746 | MEDTLVNNVPLPNTLPLPK | T | 14 | 2173 |
10022258 | ETIQQSSSLTSVPPTTFSLTFK | T | 16 | 2195 |
10023302 | STTPTSSPFR | S | 6 | 2637 |
10034276 | STTTSDPPNICK | T | 2 | 2283 |
ID | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Condition | log2Ratio | P Value | Data Source PMID | Comments |
---|---|---|---|---|---|---|---|---|---|---|
1416 | MS | HTP | ambiguous | mouse | mouse embryonic fibroblasts (MEFs) | None | 27669760 | |||
6837 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6838 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6839 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6840 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6858 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6860 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6861 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6862 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6863 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6864 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6865 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6873 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6875 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6877 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6879 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6881 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6882 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6883 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6904 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6905 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6906 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6907 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6908 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6909 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6913 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
6916 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
9548 | MS | HTP | ambiguous | mouse | hippocampus | None | 32848054 | |||
9549 | MS | HTP | ambiguous | mouse | hippocampus | None | 32848054 | |||
9550 | MS | HTP | ambiguous | mouse | hippocampus | None | 32848054 | |||
9551 | MS | HTP | ambiguous | mouse | hippocampus | None | 32848054 | |||
9552 | MS | HTP | ambiguous | mouse | hippocampus | None | 32848054 | |||
9553 | MS | HTP | ambiguous | mouse | hippocampus | None | 32848054 | |||
9554 | MS | HTP | ambiguous | mouse | hippocampus | None | 32848054 | |||
10001282 | MS | HTP | unambiguous | mouse | placenta | female/male | None | 30059200 | ||
10003596 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
10003764 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
10003797 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
10003835 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
10003941 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
10004017 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
10004057 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
10004129 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
10004180 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
10004399 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
10004400 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
10004401 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
10004402 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
10004403 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
10004593 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | None | 36852467 | |||
10004786 | MS | HTP | unambiguous | mouse | RA-induced differentiated ESCs | None | 36852467 | |||
10004822 | MS | HTP | unambiguous | mouse | RA-induced differentiated ESCs | None | 36852467 | |||
10004868 | MS | HTP | unambiguous | mouse | RA-induced differentiated ESCs | None | 36852467 | |||
10004987 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | control/RA-induced differentiated | None | 0.013707657 | 36852467 | |
10004988 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | control/RA-induced differentiated | None | 0.014803989 | 36852467 | |
10004989 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | control/RA-induced differentiated | None | 0.066195726 | 36852467 | |
10004990 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | control/RA-induced differentiated | None | 0.147120089 | 36852467 | |
10006777 | MS | HTP | unambiguous | mouse | brain | None | 22517741 | This position assigment in the protein sequence seems problematic, which could not be curated | ||
10006961 | MS | HTP | unambiguous | mouse | brain | None | 22517741 | This position assigment in the protein sequence seems problematic, which could not be curated | ||
10007215 | MS | HTP | unambiguous | mouse | brain (synaptosome) | None | 22645316 | |||
10007364 | MS | HTP | unambiguous | mouse | brain (synaptosome) | None | 22645316 | |||
10007634 | MS | HTP | unambiguous | mouse | brain (synaptosome) | None | 22645316 | |||
10012381 | MS | HTP | unambiguous | mouse | placentas | None | 30059200 | |||
10017012 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
10017013 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
10017014 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
10017015 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
10017016 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
10017017 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
10017018 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
10017019 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
10017020 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
10017021 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | None | 32782141 | |||
10018323 | MS | HTP | unambiguous | mouse | hippocampus | None | 32848054 | |||
10018324 | MS | HTP | unambiguous | mouse | hippocampus | None | 32848054 | |||
10018325 | MS | HTP | unambiguous | mouse | hippocampus | None | 32848054 | |||
10018326 | MS | HTP | unambiguous | mouse | hippocampus | None | 32848054 | |||
10019742 | MS | HTP | unambiguous | mouse | NIH3T3 cells | None | 29237092 | |||
10019814 | MS | HTP | unambiguous | mouse | NIH3T3 cells | None | 29237092 | |||
10021648 | MS | HTP | unambiguous | mouse | synaptosome | None | 34678516 | |||
10021746 | MS | HTP | unambiguous | mouse | synaptosome | None | 34678516 | |||
10022258 | MS | HTP | unambiguous | mouse | synaptosome | None | 34678516 | |||
10023302 | MS | HTP | unambiguous | mouse | cortex | TMG/control | None | 0.001382 | doi.org/10.3389/fragi.2021.757801 | |
10034276 | MS | HTP | unambiguous | mouse | brain | None | 26192747 |
ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Data Source PMID | Comments |
---|---|---|---|---|---|---|---|---|---|---|---|
1416 | STTPTSSPFR | S | 1 | 2632 | MS | HTP | ambiguous | mouse | mouse embryonic fibroblasts (MEFs) | 27669760 | |
6837 | LPSAQTSNGTDFVAAGK | T | 6 | 1917 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6838 | SMPTSQSHGSLTAELWDSK | S | 1 | 1929 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6839 | SMPTSQSHGSLTAELWDSK | T | 4 | 1932 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6840 | SMPTSQSHGSLTAELWDSK | S | 7 | 1935 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6858 | ESVTDYTTPSSSLPNTVATNNAK | S | 2 | 2138 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6860 | ESVTDYTTPSSSLPNTVATNNAK | T | 4 | 2140 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6861 | ESVTDYTTPSSSLPNTVATNNAK | T | 7 | 2143 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6862 | ESVTDYTTPSSSLPNTVATNNAK | T | 8 | 2144 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6863 | ESVTDYTTPSSSLPNTVATNNAK | S | 10 | 2146 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6864 | ESVTDYTTPSSSLPNTVATNNAK | S | 11 | 2147 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6865 | ESVTDYTTPSSSLPNTVATNNAK | S | 12 | 2148 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6873 | ETIQQSSSLTSVPPTTFSLTFK | S | 6 | 2185 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6875 | RETIQQSSSLTSVPPTTFSLTFK | S | 9 | 2187 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6877 | RETIQQSSSLTSVPPTTFSLTFK | T | 11 | 2189 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6879 | RETIQQSSSLTSVPPTTFSLTFK | T | 17 | 2195 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6881 | STTTSDPPNICK | S | 1 | 2282 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6882 | STTTSDPPNICK | T | 3 | 2284 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6883 | STTTSDPPNICK | T | 4 | 2285 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6904 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 8 | 2428 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6905 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 9 | 2429 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6906 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 11 | 2431 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6907 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 14 | 2434 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6908 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 18 | 2438 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6909 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | T | 20 | 2440 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6913 | GLIPAGTQHSMMATTGK | S | 10 | 2599 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
6916 | STTPTSSPFR | T | 2 | 2633 | MS | HTP | ambiguous | mouse | embryonic fibroblasts | 32782141 | |
9548 | ESVTDYTTPSSSLPNTVATNNAK | S | 11 | 2147 | MS | HTP | ambiguous | mouse | hippocampus | 32848054 | |
9549 | RETIQQSSSLTSVPPTTFSLTFK | T | 16 | 2194 | MS | HTP | ambiguous | mouse | hippocampus | 32848054 | |
9550 | RETIQQSSSLTSVPPTTFSLTFK | S | 19 | 2197 | MS | HTP | ambiguous | mouse | hippocampus | 32848054 | |
9551 | ETIQQSSSLTSVPPTTFSLTFK | T | 20 | 2199 | MS | HTP | ambiguous | mouse | hippocampus | 32848054 | |
9552 | STTTSDPPNICK | T | 2 | 2283 | MS | HTP | ambiguous | mouse | hippocampus | 32848054 | |
9553 | STTTSDPPNICK | T | 3 | 2284 | MS | HTP | ambiguous | mouse | hippocampus | 32848054 | |
9554 | ATSTSPNSQSSK | T | 4 | 2645 | MS | HTP | ambiguous | mouse | hippocampus | 32848054 | |
10001282 | RETIQQSSSLTSVPPTTFSLTFK | T | 17 | 2195 | MS | HTP | unambiguous | mouse | placenta | 30059200 | |
10003596 | T | 2173 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10003764 | T | 2195 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10003797 | S | 2190 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10003835 | S | 1918 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10003941 | S | 2197 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10004017 | S | 882 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10004057 | S | 2431 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10004129 | S | 2148 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10004180 | T | 1932 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10004399 | S | 2585 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10004400 | S | 1933 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10004401 | S | 878 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10004402 | T | 2194 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10004403 | S | 2429 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10004593 | S | 2632 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10004786 | S | 1929 | MS | HTP | unambiguous | mouse | RA-induced differentiated ESCs | 36852467 | |||
10004822 | T | 2181 | MS | HTP | unambiguous | mouse | RA-induced differentiated ESCs | 36852467 | |||
10004868 | S | 2421 | MS | HTP | unambiguous | mouse | RA-induced differentiated ESCs | 36852467 | |||
10004987 | S | 1929 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10004988 | S | 2421 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10004989 | T | 2181 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10004990 | T | 2163 | MS | HTP | unambiguous | mouse | embryonic stem cells (ESCs) | 36852467 | |||
10006777 | TSVPPTTFSLTFK | T | 2177 | MS | HTP | unambiguous | mouse | brain | 22517741 | This position assigment in the protein sequence seems problematic, which could not be curated | |
10006961 | SIQPYRSQPAFMQ | S | 2403 | MS | HTP | unambiguous | mouse | brain | 22517741 | This position assigment in the protein sequence seems problematic, which could not be curated | |
10007215 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 1 | 2421 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | |
10007364 | SMPTSQSHGSLTAELWDSK | S | 5 | 1933 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | |
10007634 | GLIPAGTQHSMMATTGK | T | 7 | 2596 | MS | HTP | unambiguous | mouse | brain (synaptosome) | 22645316 | |
10012381 | RETIQQSSSLTSVPPTTFSLTFK | T | 17 | 2195 | MS | HTP | unambiguous | mouse | placentas | 30059200 | |
10017012 | LPSAQTSNGTDFVAAGK | S | 7 | 1918 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
10017013 | SMPTSQSHGSLTAELWDSK | S | 5 | 1933 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
10017014 | RETIQQSSSLTSVPPTTFSLTFK | S | 12 | 2190 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
10017015 | RETIQQSSSLTSVPPTTFSLTFK | T | 16 | 2194 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
10017016 | STTTSDPPNICK | T | 2 | 2283 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
10017017 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 1 | 2421 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
10017018 | GLIPAGTQHSMMATTGK | T | 7 | 2596 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
10017019 | STTPTSSPFR | S | 1 | 2632 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
10017020 | STTPTSSPFR | T | 3 | 2634 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
10017021 | STTPTSSPFR | S | 6 | 2637 | MS | HTP | unambiguous | mouse | embryonic fibroblasts | 32782141 | |
10018323 | ESVTDYTTPSSSLPNTVATNNAK | S | 12 | 2148 | MS | HTP | unambiguous | mouse | hippocampus | 32848054 | |
10018324 | ETIQQSSSLTSVPPTTFSLTFK | T | 16 | 2195 | MS | HTP | unambiguous | mouse | hippocampus | 32848054 | |
10018325 | SQPAFMQSSLSQPSVVLSGTAIHNFPAVQHQELAK | S | 1 | 2421 | MS | HTP | unambiguous | mouse | hippocampus | 32848054 | |
10018326 | ATSTSPNSQSSK | S | 3 | 2644 | MS | HTP | unambiguous | mouse | hippocampus | 32848054 | |
10019742 | RETIQQSSSLTSVPPTTFSLTFK | S | 2190 | MS | HTP | unambiguous | mouse | NIH3T3 cells | 29237092 | ||
10019814 | RETIQQSSSLTSVPPTTFSLTFK | T | 2195 | MS | HTP | unambiguous | mouse | NIH3T3 cells | 29237092 | ||
10021648 | RETIQQSSSLTSVPPTTFSLTFK | T | 16 | 2194 | MS | HTP | unambiguous | mouse | synaptosome | 34678516 | |
10021746 | MEDTLVNNVPLPNTLPLPK | T | 14 | 2173 | MS | HTP | unambiguous | mouse | synaptosome | 34678516 | |
10022258 | ETIQQSSSLTSVPPTTFSLTFK | T | 16 | 2195 | MS | HTP | unambiguous | mouse | synaptosome | 34678516 | |
10023302 | STTPTSSPFR | S | 6 | 2637 | MS | HTP | unambiguous | mouse | cortex | doi.org/10.3389/fragi.2021.757801 | |
10034276 | STTTSDPPNICK | T | 2 | 2283 | MS | HTP | unambiguous | mouse | brain | 26192747 |