Details for Accession #: Q13586


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
10002081 172
10003346 170
10011426 RKLQLSGHAMPRLAVTNTTMTGTVLKMTDRS T 170
10016846 T 626
10016847 S 621
10021081 170
10028145 LAVTNTTMTGTVLK T 4 170
10029133 LAVTNTTMTGTVLK T 4 170
10030491 T 170
10033010 LAVTNTTM*TGTVLK T 6 172
10041534 T 172

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
10002081 MS HTP unambiguous human HeLa cells Interphase/Mitosis None 34161081 The p value was -log10p in original paper.
10003346 MS HTP unambiguous human colorectal cancer (CRC) cell lines SW620 cells/SW480 cells None 0.223024134 35254053
10011426 MS HTP unambiguous human HeLa cells None 30059200
10016846 prediction and site-directed mutagenesis LTP unambiguous human HEK 293 cells None 33023909
10016847 prediction and site-directed mutagenesis LTP unambiguous human HEK 293 cells None 33023909
10021081 MS HTP unambiguous human HeLa cells None 34161081
10028145 MS HTP unambiguous human SW480 cells None 35254053
10029133 MS HTP unambiguous human SW620 cells None 35254053
10030491 MS HTP unambiguous human SW480 cells, SW620 cells SW620/SW480 None 0.223024134 35254053
10033010 MS HTP unambiguous human Jurkat cells None 35705054
10041534 MS HTP unambiguous human PANC-1 cells None 39531497

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10002081 172 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10003346 170 MS HTP unambiguous human colorectal cancer (CRC) cell lines 35254053
10011426 RKLQLSGHAMPRLAVTNTTMTGTVLKMTDRS T 170 MS HTP unambiguous human HeLa cells 30059200
10016846 T 626 prediction and site-directed mutagenesis LTP unambiguous human HEK 293 cells 33023909
10016847 S 621 prediction and site-directed mutagenesis LTP unambiguous human HEK 293 cells 33023909
10021081 170 MS HTP unambiguous human HeLa cells 34161081
10028145 LAVTNTTMTGTVLK T 4 170 MS HTP unambiguous human SW480 cells 35254053
10029133 LAVTNTTMTGTVLK T 4 170 MS HTP unambiguous human SW620 cells 35254053
10030491 T 170 MS HTP unambiguous human SW480 cells, SW620 cells 35254053
10033010 LAVTNTTM*TGTVLK T 6 172 MS HTP unambiguous human Jurkat cells 35705054
10041534 T 172 MS HTP unambiguous human PANC-1 cells 39531497