| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein |
|---|---|---|---|---|
| 10006047 | FNVGEDCPVFDGLFEFCQLSTGGSVASAVK | T | 21 | 114 |
| 10006048 | SEASGFCYVNDIVLAILELLK | S | 1 | 145 |
| 10006049 | VMEMFQPSAVVLQCGSDSLSGDR | S | 16 | 263 |
| ID | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Condition | log2Ratio | P Value | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|
| 10006047 | MS | LTP | unambiguous | human | HepG2 cells | None | 27060025 | No sequence provided in original paper; the peptide sequence is inferredfrom tryptic cleavage | ||
| 10006048 | MS | LTP | unambiguous | human | HepG2 cells | None | 27060025 | No sequence provided in original paper; the peptide sequence is inferredfrom tryptic cleavage | ||
| 10006049 | MS | LTP | unambiguous | human | HepG2 cells | None | 27060025 | No sequence provided in original paper; the peptide sequence is inferredfrom tryptic cleavage |
| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 10006047 | FNVGEDCPVFDGLFEFCQLSTGGSVASAVK | T | 21 | 114 | MS | LTP | unambiguous | human | HepG2 cells | 27060025 | No sequence provided in original paper; the peptide sequence is inferredfrom tryptic cleavage |
| 10006048 | SEASGFCYVNDIVLAILELLK | S | 1 | 145 | MS | LTP | unambiguous | human | HepG2 cells | 27060025 | No sequence provided in original paper; the peptide sequence is inferredfrom tryptic cleavage |
| 10006049 | VMEMFQPSAVVLQCGSDSLSGDR | S | 16 | 263 | MS | LTP | unambiguous | human | HepG2 cells | 27060025 | No sequence provided in original paper; the peptide sequence is inferredfrom tryptic cleavage |