O-GlcNAc Database

Details for Accession #: Q12778

Protein Sequence

Peptide Information

ID	Peptide Seq	Site Residue	Position in Peptide	Position in Protein
3222	TTTHSWVSG	T		647
3223	TTTHSWVSG	T		648
3224	TTTHSWVSG	T		649
3225	TTTHSWVS	S		651
3226	TTTHSWVSG	S		654
10000968	TTTHSWVSG	T	2	648
10005699	WPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAK	T	23	317
10005700	MMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVK	S	35	550
10005701	DNVLPNQSFPHSVKTTTHSWVSG	T	16	648
10005702	DNVLPNQSFPHSVKTTTHSWVSG	S	22	654
10005987	TTTHSWVSGGIHRPVATMVSK	T	3	649
10011401	DNVLPNQSFPHSVKTTTHSWVSG	T		648
10016164	TTTHSWVSG	T	3	649
10016528	TTTHSWVSG	S	8	654
10026338	TTTHSWVSG	S	8	654
10029119	TTTHSWVSG	T	2	648
10033674	TTTHSWVSG	T	2	648
10036820	TSSNASTISGR			317
10037295	TTTHSWVSG			648
10037387	TTTHSWVSG			648

O-GlcNAcylation Information

ID	Method	Analytical Throughput	Ambiguity	Species	Sample Type	Condition	log2Ratio	Data Source PMID	Comments
3222	MS	HTP	ambiguous	human	T cells		None	29351928
3223	MS	HTP	ambiguous	human	T cells		None	29351928
3224	MS	HTP	ambiguous	human	T cells		None	29351928
3225	MS	HTP	ambiguous	human	T cells		None	29351928
3226	MS	HTP	ambiguous	human	T cells		None	29351928
10000968	MS	HTP	unambiguous	human	HeLa cells	20 uM GalNAz/200 uM GalNAz	None	30059200
10005699	MS, site-directed mutagenesis	LTP	unambiguous	human	Fao cells		None	18420577
10005700	MS, site-directed mutagenesis	LTP	unambiguous	human	Fao cells		None	18420577
10005701	MS, site-directed mutagenesis	LTP	unambiguous	human	Fao cells		None	18420577
10005702	MS, site-directed mutagenesis	LTP	unambiguous	human	Fao cells		None	18420577
10005987	MS, site-directed mutagenesis	LTP	unambiguous	human	HEK 293 cells		None	25944660	This site was described as T646 of the protein sequence in the original paper
10011401	MS	HTP	unambiguous	human	HeLa cells		None	30059200
10016164	MS	HTP	unambiguous	human	MCF-7 cells		None	32574038
10016528	MS	HTP	unambiguous	human	MCF-7 cells		None	32574038
10026338	MS	HTP	unambiguous	human	HeLa cells		None	35254053
10029119	MS	HTP	unambiguous	human	SW620 cells		None	35254053
10033674	MS	HTP	unambiguous	human	HEK 293T cells	glucose-deprived/glucose-sufficient	None	37541260
10036820	MS	HTP	unambiguous	human	HepG2 cells		None	30620550
10037295	MS	HTP	unambiguous	human	HEK 293T cells	TMG/control	None	30620550	Peptide quantification value was applied to each modification site
10037387	MS	HTP	unambiguous	human	HepG2 cells	orafenib sensitive/resistant	None	30620550	Peptide quantification value was applied to each modification site

ID	Peptide Seq	Site Residue	Position in Peptide	Position in Protein	Method	Analytical Throughput	Ambiguity	Species	Sample Type	Data Source PMID	Comments
3222	TTTHSWVSG	T		647	MS	HTP	ambiguous	human	T cells	29351928
3223	TTTHSWVSG	T		648	MS	HTP	ambiguous	human	T cells	29351928
3224	TTTHSWVSG	T		649	MS	HTP	ambiguous	human	T cells	29351928
3225	TTTHSWVS	S		651	MS	HTP	ambiguous	human	T cells	29351928
3226	TTTHSWVSG	S		654	MS	HTP	ambiguous	human	T cells	29351928
10000968	TTTHSWVSG	T	2	648	MS	HTP	unambiguous	human	HeLa cells	30059200
10005699	WPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAK	T	23	317	MS, site-directed mutagenesis	LTP	unambiguous	human	Fao cells	18420577
10005700	MMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVK	S	35	550	MS, site-directed mutagenesis	LTP	unambiguous	human	Fao cells	18420577
10005701	DNVLPNQSFPHSVKTTTHSWVSG	T	16	648	MS, site-directed mutagenesis	LTP	unambiguous	human	Fao cells	18420577
10005702	DNVLPNQSFPHSVKTTTHSWVSG	S	22	654	MS, site-directed mutagenesis	LTP	unambiguous	human	Fao cells	18420577
10005987	TTTHSWVSGGIHRPVATMVSK	T	3	649	MS, site-directed mutagenesis	LTP	unambiguous	human	HEK 293 cells	25944660	This site was described as T646 of the protein sequence in the original paper
10011401	DNVLPNQSFPHSVKTTTHSWVSG	T		648	MS	HTP	unambiguous	human	HeLa cells	30059200
10016164	TTTHSWVSG	T	3	649	MS	HTP	unambiguous	human	MCF-7 cells	32574038
10016528	TTTHSWVSG	S	8	654	MS	HTP	unambiguous	human	MCF-7 cells	32574038
10026338	TTTHSWVSG	S	8	654	MS	HTP	unambiguous	human	HeLa cells	35254053
10029119	TTTHSWVSG	T	2	648	MS	HTP	unambiguous	human	SW620 cells	35254053
10033674	TTTHSWVSG	T	2	648	MS	HTP	unambiguous	human	HEK 293T cells	37541260
10036820	TSSNASTISGR			317	MS	HTP	unambiguous	human	HepG2 cells	30620550
10037295	TTTHSWVSG			648	MS	HTP	unambiguous	human	HEK 293T cells	30620550	Peptide quantification value was applied to each modification site
10037387	TTTHSWVSG			648	MS	HTP	unambiguous	human	HepG2 cells	30620550	Peptide quantification value was applied to each modification site