Details for Accession #: Q09472


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
256 MESTETEERSTELK
3205 LGLGLDDESNNQQAAATQSPGDSRRLSIQR S 1734
10902 MESTETEERSTELK
10000964 PQSQPPHSSPSPR S 8 2325
10000965 PQSQPPHSSPSPR S 8 2361
10011396 PQPVPSPRPQSQPPHSSPSPRMQPQPSPHHV S 2325
10012974 ESTETEERSTELK S 1010
10012975 ESTETEERSTELK T 1009
10015532 PQSQPPHSSPSPR S 8 2325
10015846 TQAAGPVSQGK T 1 1890
10023597 SGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVK S 20 106
10024103 TQAAGPVSQGK T 1890
10027008 TQAAGPVSQGK T 1 1890
10029937 TQAAGPVSQGK T 1 1890
10032408 SGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVK S 106
10032890 TQAAGPVSQGK T 1890

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
256 MS HTP ambiguous human HeLa cells ionizing radiation/control None 0.004748118 30379171
3205 MS HTP ambiguous human T cells None 29351928
10902 MS HTP ambiguous human HeLa cells None 30379171
10000964 MS HTP unambiguous human HeLa cells 20 uM GalNAz/200 uM GalNAz None 30059200
10000965 MS HTP unambiguous human HeLa cells 20 uM GalNAz/200 uM GalNAz None 30059200
10011396 MS HTP unambiguous human HeLa cells None 30059200
10012974 MS HTP unambiguous human HeLa cells None 30379171 This position assigment in the protein sequence seems problematic, which could not be curated
10012975 MS HTP unambiguous human HeLa cells None 30379171 This position assigment in the protein sequence seems problematic, which could not be curated
10015532 MS HTP unambiguous human HeLa cells None 31492838
10015846 MS HTP unambiguous human liver None 31637018
10023597 MS HTP unambiguous human THP1 cells None 32938750
10024103 MS HTP unambiguous human liver None 31637018
10027008 MS HTP unambiguous human HeLa cells None 35254053
10029937 MS HTP unambiguous human SW620 cells None 35254053
10032408 MS HTP unambiguous human MCF-7 cells None 35513511
10032890 MS HTP unambiguous human MCF-7 cells None 35513511

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
256 MESTETEERSTELK MS HTP ambiguous human HeLa cells 30379171
3205 LGLGLDDESNNQQAAATQSPGDSRRLSIQR S 1734 MS HTP ambiguous human T cells 29351928
10902 MESTETEERSTELK MS HTP ambiguous human HeLa cells 30379171
10000964 PQSQPPHSSPSPR S 8 2325 MS HTP unambiguous human HeLa cells 30059200
10000965 PQSQPPHSSPSPR S 8 2361 MS HTP unambiguous human HeLa cells 30059200
10011396 PQPVPSPRPQSQPPHSSPSPRMQPQPSPHHV S 2325 MS HTP unambiguous human HeLa cells 30059200
10012974 ESTETEERSTELK S 1010 MS HTP unambiguous human HeLa cells 30379171 This position assigment in the protein sequence seems problematic, which could not be curated
10012975 ESTETEERSTELK T 1009 MS HTP unambiguous human HeLa cells 30379171 This position assigment in the protein sequence seems problematic, which could not be curated
10015532 PQSQPPHSSPSPR S 8 2325 MS HTP unambiguous human HeLa cells 31492838
10015846 TQAAGPVSQGK T 1 1890 MS HTP unambiguous human liver 31637018
10023597 SGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVK S 20 106 MS HTP unambiguous human THP1 cells 32938750
10024103 TQAAGPVSQGK T 1890 MS HTP unambiguous human liver 31637018
10027008 TQAAGPVSQGK T 1 1890 MS HTP unambiguous human HeLa cells 35254053
10029937 TQAAGPVSQGK T 1 1890 MS HTP unambiguous human SW620 cells 35254053
10032408 SGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVK S 106 MS HTP unambiguous human MCF-7 cells 35513511
10032890 TQAAGPVSQGK T 1890 MS HTP unambiguous human MCF-7 cells 35513511