Details for Accession #: Q07157


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
10001880 976
10010358 RSFENK S 2 1366
10012966 TPTSPKTLVK S 1570
10012967 TPTSPKTLVK T 1569
10012968 YESSSYTDQFSR S 1071
10015226 TPSTEAAHIMLR T 4 979
10015845 TPSTEAAHIMLR S 3 978
10021252 979
10024102 TPSTEAAHIMLR S 978
10026336 TPSTEAAHIMLR T 1 976
10027558 RYEPIQATPPPPPLPSQYAQPSQPVTSASLHIHSK T 8 1425
10027690 TPSTEAAHIMLR T 4 979
10028129 TPSTEAAHIMLR T 1 976
10029669 TPSTEAAHIMLR T 1 976
10038884 T 979
10041454 T 976
10045016 RYEPIQATPPPPPLPSQYAQPSQPVTSASLHIHSK T 26 1443

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
10001880 MS HTP unambiguous human HeLa cells Interphase/Mitosis None 34161081 The p value was -log10p in original paper.
10010358 MS HTP unambiguous human T cells None 29351928
10012966 MS HTP unambiguous human HeLa cells None 30379171
10012967 MS HTP unambiguous human HeLa cells None 30379171
10012968 MS HTP unambiguous human HeLa cells None 30379171
10015226 MS HTP unambiguous human HeLa cells None 31492838
10015845 MS HTP unambiguous human liver None 31637018
10021252 MS HTP unambiguous human HeLa cells None 34161081
10024102 MS HTP unambiguous human liver None 31637018
10026336 MS HTP unambiguous human HeLa cells None 35254053
10027558 MS HTP unambiguous human HeLa cells None 35254053
10027690 MS HTP unambiguous human HeLa cells None 35254053
10028129 MS HTP unambiguous human SW480 cells None 35254053
10029669 MS HTP unambiguous human SW620 cells None 35254053
10038884 MS HTP unambiguous human PANC-1 cells None 39302247
10041454 MS HTP unambiguous human PANC-1 cells None 39531497
10045016 MS HTP unambiguous human HeLa cells: nucleus None 39534244

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10001880 976 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10010358 RSFENK S 2 1366 MS HTP unambiguous human T cells 29351928
10012966 TPTSPKTLVK S 1570 MS HTP unambiguous human HeLa cells 30379171
10012967 TPTSPKTLVK T 1569 MS HTP unambiguous human HeLa cells 30379171
10012968 YESSSYTDQFSR S 1071 MS HTP unambiguous human HeLa cells 30379171
10015226 TPSTEAAHIMLR T 4 979 MS HTP unambiguous human HeLa cells 31492838
10015845 TPSTEAAHIMLR S 3 978 MS HTP unambiguous human liver 31637018
10021252 979 MS HTP unambiguous human HeLa cells 34161081
10024102 TPSTEAAHIMLR S 978 MS HTP unambiguous human liver 31637018
10026336 TPSTEAAHIMLR T 1 976 MS HTP unambiguous human HeLa cells 35254053
10027558 RYEPIQATPPPPPLPSQYAQPSQPVTSASLHIHSK T 8 1425 MS HTP unambiguous human HeLa cells 35254053
10027690 TPSTEAAHIMLR T 4 979 MS HTP unambiguous human HeLa cells 35254053
10028129 TPSTEAAHIMLR T 1 976 MS HTP unambiguous human SW480 cells 35254053
10029669 TPSTEAAHIMLR T 1 976 MS HTP unambiguous human SW620 cells 35254053
10038884 T 979 MS HTP unambiguous human PANC-1 cells 39302247
10041454 T 976 MS HTP unambiguous human PANC-1 cells 39531497
10045016 RYEPIQATPPPPPLPSQYAQPSQPVTSASLHIHSK T 26 1443 MS HTP unambiguous human HeLa cells: nucleus 39534244