| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein |
|---|---|---|---|---|
| 3169 | ADPSLQAPVRVSMQL | S | 269 | |
| 10005801 | SPFSGPTDPR | T | 7 | 322 |
| 10005802 | SSASVPKPAPQPYPFTSSLSTINY | T | 16 | 352 |
| 10005846 | RTYETFK | T | 2 | 305 |
| 10006111 | SPFSGPTDPR | S | 4 | 319 |
| 10006112 | IAVPSRSSASVPKPAPQPYPF | S | 7 | 337 |
| 10006113 | VFPSGQISQASALAPAPPQVLPQAPAPAPAPAM | S | 8 | 374 |
| 10006114 | VFPSGQISQASALAPAPPQVLPQAPAPAPAPAM | S | 11 | 377 |
| 10010551 | SGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPF | S | 19 | 337 |
| 10015844 | SSASVPK | S | 1 | 337 |
| 10024101 | SSASVPK | S | 337 | |
| 10027648 | SSASVPK | S | 1 | 337 |
| 10034110 | LVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS | S | 48 | 550 |
| 10034111 | LVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS | S | 49 | 551 |
| ID | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Condition | log2Ratio | P Value | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|
| 3169 | MS | HTP | ambiguous | human | T cells | 29351928 | ||||
| 10005801 | prediction and site-directed mutagenesis | LTP | unambiguous | human | A549 cells | 18988733 | No mass spec. data provided; the peptide sequence is inferred from tryptic cleavage | |||
| 10005802 | MS, prediction and site-directed mutagenesis | LTP | unambiguous | human | A549 cells | 18988733 | ||||
| 10005846 | prediction and site-directed mutagenesis | LTP | unambiguous | human | HEK 293T cells | 23027940 | No mass spec. data provided; the peptide sequence is inferred from tryptic cleavage | |||
| 10006111 | MS, site-directed mutagenesis | LTP | unambiguous | human | HEK 293T cells | 28416608 | No mass spec. data provided; the peptide sequence was inferred from tryptic cleavage | |||
| 10006112 | MS, site-directed mutagenesis | LTP | unambiguous | human | HEK 293T cells | 28416608 | ||||
| 10006113 | MS, site-directed mutagenesis | LTP | unambiguous | human | HEK 293T cells | 28416608 | ||||
| 10006114 | MS, site-directed mutagenesis | LTP | unambiguous | human | HEK 293T cells | 28416608 | ||||
| 10010551 | MS | HTP | unambiguous | human | T cells | 29351928 | ||||
| 10015844 | MS | HTP | unambiguous | human | liver | 31637018 | ||||
| 10024101 | MS | HTP | unambiguous | human | liver | 31637018 | ||||
| 10027648 | MS | HTP | unambiguous | human | HeLa cells | 35254053 | ||||
| 10034110 | MS, site-directed mutagenesis | LTP | unambiguous | human | HEK 293 cells | 37835439 | ||||
| 10034111 | MS, site-directed mutagenesis | LTP | unambiguous | human | HEK 293 cells | 37835439 |
| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 3169 | ADPSLQAPVRVSMQL | S | 269 | MS | HTP | ambiguous | human | T cells | 29351928 | ||
| 10005801 | SPFSGPTDPR | T | 7 | 322 | prediction and site-directed mutagenesis | LTP | unambiguous | human | A549 cells | 18988733 | No mass spec. data provided; the peptide sequence is inferred from tryptic cleavage |
| 10005802 | SSASVPKPAPQPYPFTSSLSTINY | T | 16 | 352 | MS, prediction and site-directed mutagenesis | LTP | unambiguous | human | A549 cells | 18988733 | |
| 10005846 | RTYETFK | T | 2 | 305 | prediction and site-directed mutagenesis | LTP | unambiguous | human | HEK 293T cells | 23027940 | No mass spec. data provided; the peptide sequence is inferred from tryptic cleavage |
| 10006111 | SPFSGPTDPR | S | 4 | 319 | MS, site-directed mutagenesis | LTP | unambiguous | human | HEK 293T cells | 28416608 | No mass spec. data provided; the peptide sequence was inferred from tryptic cleavage |
| 10006112 | IAVPSRSSASVPKPAPQPYPF | S | 7 | 337 | MS, site-directed mutagenesis | LTP | unambiguous | human | HEK 293T cells | 28416608 | |
| 10006113 | VFPSGQISQASALAPAPPQVLPQAPAPAPAPAM | S | 8 | 374 | MS, site-directed mutagenesis | LTP | unambiguous | human | HEK 293T cells | 28416608 | |
| 10006114 | VFPSGQISQASALAPAPPQVLPQAPAPAPAPAM | S | 11 | 377 | MS, site-directed mutagenesis | LTP | unambiguous | human | HEK 293T cells | 28416608 | |
| 10010551 | SGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPF | S | 19 | 337 | MS | HTP | unambiguous | human | T cells | 29351928 | |
| 10015844 | SSASVPK | S | 1 | 337 | MS | HTP | unambiguous | human | liver | 31637018 | |
| 10024101 | SSASVPK | S | 337 | MS | HTP | unambiguous | human | liver | 31637018 | ||
| 10027648 | SSASVPK | S | 1 | 337 | MS | HTP | unambiguous | human | HeLa cells | 35254053 | |
| 10034110 | LVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS | S | 48 | 550 | MS, site-directed mutagenesis | LTP | unambiguous | human | HEK 293 cells | 37835439 | |
| 10034111 | LVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS | S | 49 | 551 | MS, site-directed mutagenesis | LTP | unambiguous | human | HEK 293 cells | 37835439 |