Details for Accession #: P78337


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
10000949 SLAPAPLSTK S 1 188
10002775 188
10003037 196
10005408 SLAPAPLSTK T 9 196
10011368 DVYAAGYSYNNWAAKSLAPAPLSTKSFTFFN S 188
10015211 SLAPAPLSTK S 1 188
10019468 SLAPAPLSTK S 1 188
10021078 196
10022512 SLAPAPLSTK S 2 188
10025933 SLAPAPLSTK S 1 188
10025934 SLAPAPLSTK T 9 196
10028112 SLAPAPLSTK S 1 188
10028113 SLAPAPLSTK T 9 196
10029104 SLAPAPLSTK S 1 188
10029105 SLAPAPLSTK T 9 196
10030195 T 196
10030993 SLAPAPLSTK S 1 188
10032395 SLAPAPLSTK S 188
10036679 SLAPAPLSTK S 188

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
10000949 MS HTP unambiguous human HeLa cells 20 uM GalNAz/200 uM GalNAz None 30059200
10002775 MS HTP unambiguous human HeLa cells Mitotic exit/Early mitosis None 34161081 The p value was -log10p in original paper.
10003037 MS HTP unambiguous human colorectal cancer (CRC) cell lines SW620 cells/SW480 cells None 0.001468634 35254053
10005408 MS HTP unambiguous human HEK 293T cells glucose-deprived/glucose-sufficient None 37541260
10011368 MS HTP unambiguous human HeLa cells None 30059200
10015211 MS HTP unambiguous human HeLa cells None 31492838
10019468 MS HTP unambiguous human Hela cells None 29237092
10021078 MS HTP unambiguous human HeLa cells None 34161081
10022512 MS HTP unambiguous human HeLa cells None 34846842
10025933 MS HTP unambiguous human HeLa cells None 35254053
10025934 MS HTP unambiguous human HeLa cells None 35254053
10028112 MS HTP unambiguous human SW480 cells None 35254053
10028113 MS HTP unambiguous human SW480 cells None 35254053
10029104 MS HTP unambiguous human SW620 cells None 35254053
10029105 MS HTP unambiguous human SW620 cells None 35254053
10030195 MS HTP unambiguous human SW480 cells, SW620 cells SW620/SW480 None 0.001468634 35254053
10030993 MS HTP unambiguous human HeLa cell nucleus None 35289036
10032395 MS HTP unambiguous human MCF-7 cells None 35513511
10036679 MS HTP unambiguous human HEK 293T cells None 30620550

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10000949 SLAPAPLSTK S 1 188 MS HTP unambiguous human HeLa cells 30059200
10002775 188 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10003037 196 MS HTP unambiguous human colorectal cancer (CRC) cell lines 35254053
10005408 SLAPAPLSTK T 9 196 MS HTP unambiguous human HEK 293T cells 37541260
10011368 DVYAAGYSYNNWAAKSLAPAPLSTKSFTFFN S 188 MS HTP unambiguous human HeLa cells 30059200
10015211 SLAPAPLSTK S 1 188 MS HTP unambiguous human HeLa cells 31492838
10019468 SLAPAPLSTK S 1 188 MS HTP unambiguous human Hela cells 29237092
10021078 196 MS HTP unambiguous human HeLa cells 34161081
10022512 SLAPAPLSTK S 2 188 MS HTP unambiguous human HeLa cells 34846842
10025933 SLAPAPLSTK S 1 188 MS HTP unambiguous human HeLa cells 35254053
10025934 SLAPAPLSTK T 9 196 MS HTP unambiguous human HeLa cells 35254053
10028112 SLAPAPLSTK S 1 188 MS HTP unambiguous human SW480 cells 35254053
10028113 SLAPAPLSTK T 9 196 MS HTP unambiguous human SW480 cells 35254053
10029104 SLAPAPLSTK S 1 188 MS HTP unambiguous human SW620 cells 35254053
10029105 SLAPAPLSTK T 9 196 MS HTP unambiguous human SW620 cells 35254053
10030195 T 196 MS HTP unambiguous human SW480 cells, SW620 cells 35254053
10030993 SLAPAPLSTK S 1 188 MS HTP unambiguous human HeLa cell nucleus 35289036
10032395 SLAPAPLSTK S 188 MS HTP unambiguous human MCF-7 cells 35513511
10036679 SLAPAPLSTK S 188 MS HTP unambiguous human HEK 293T cells 30620550