Details for Accession #: P50897


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
10001740 199
10002060 234
10003310 199
10011299 EYWHDPIKEDVYRNHSIFLADINQERGINES S 199
10025237 NHSIFLADINQER S 3 199
10028060 NHSIFLADINQER S 3 199
10029045 NHSIFLADINQER S 3 199
10030457 S 199
10030743 NHSIFLADINQER S 3 199

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
10001740 MS HTP unambiguous human HeLa cells Interphase/Mitosis -1.036125168 0.012915 34161081 The p value was -log10p in original paper.
10002060 MS HTP unambiguous human HeLa cells Interphase/Mitosis -100 34161081 The p value was -log10p in original paper.
10003310 MS HTP unambiguous human colorectal cancer (CRC) cell lines SW620 cells/SW480 cells 0.976153258 0.065696834 35254053
10011299 MS HTP unambiguous human HeLa cells 30059200
10025237 MS HTP unambiguous human HeLa cells 35254053
10028060 MS HTP unambiguous human SW480 cells 35254053
10029045 MS HTP unambiguous human SW620 cells 35254053
10030457 MS HTP unambiguous human SW480 cells, SW620 cells SW620/SW480 0.976153258 0.065696834 35254053
10030743 MS HTP unambiguous human HeLa cell nucleus 35289036

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10001740 199 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10002060 234 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10003310 199 MS HTP unambiguous human colorectal cancer (CRC) cell lines 35254053
10011299 EYWHDPIKEDVYRNHSIFLADINQERGINES S 199 MS HTP unambiguous human HeLa cells 30059200
10025237 NHSIFLADINQER S 3 199 MS HTP unambiguous human HeLa cells 35254053
10028060 NHSIFLADINQER S 3 199 MS HTP unambiguous human SW480 cells 35254053
10029045 NHSIFLADINQER S 3 199 MS HTP unambiguous human SW620 cells 35254053
10030457 S 199 MS HTP unambiguous human SW480 cells, SW620 cells 35254053
10030743 NHSIFLADINQER S 3 199 MS HTP unambiguous human HeLa cell nucleus 35289036