Details for Accession #: P19332


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
475 HLSNVSSTGSIDMVDSPQLATLADEVSASLAK S 3 409
476 HLSNVSSTGSIDMVDSPQLATLADEVSASLAK S 6 412
477 HLSNVSSTGSIDMVDSPQLATLADEVSASLAK S 7 413
10006192 KTPPGSGEPPK S 6 496
10006193 GEPPKSGERSG S 6 502
10006194 KSPVVSGDTSP S 6 711
10006195 HLSNVSSTGSI S 6 723
10006196 LSNVSSTGSID S 6 724

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
475 MS LTP ambiguous rat brain None 20706749 This position assignment in the protein sequence seems problematic, which has not been curated
476 MS LTP ambiguous rat brain None 20706749
477 MS LTP ambiguous rat brain None 20706749 This position assignment in the protein sequence seems problematic, which has not been curated
10006192 NMR LTP unambiguous rat brain None 30386294 The sequence was "KTPPSSGEPPK" and the site was described as 'S185' in the original paper
10006193 NMR LTP unambiguous rat brain None 30386294 This site was described as 'S191' in the original paper.
10006194 NMR LTP unambiguous rat brain None 30386294 This site was described as 'S400' in the original paper.
10006195 NMR LTP unambiguous rat brain None 30386294 This site was descriebed as 'S412' in the original paper.
10006196 NMR LTP unambiguous rat brain None 30386294 This site was described as 'S413' in the original paper.

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
475 HLSNVSSTGSIDMVDSPQLATLADEVSASLAK S 3 409 MS LTP ambiguous rat brain 20706749 This position assignment in the protein sequence seems problematic, which has not been curated
476 HLSNVSSTGSIDMVDSPQLATLADEVSASLAK S 6 412 MS LTP ambiguous rat brain 20706749
477 HLSNVSSTGSIDMVDSPQLATLADEVSASLAK S 7 413 MS LTP ambiguous rat brain 20706749 This position assignment in the protein sequence seems problematic, which has not been curated
10006192 KTPPGSGEPPK S 6 496 NMR LTP unambiguous rat brain 30386294 The sequence was "KTPPSSGEPPK" and the site was described as 'S185' in the original paper
10006193 GEPPKSGERSG S 6 502 NMR LTP unambiguous rat brain 30386294 This site was described as 'S191' in the original paper.
10006194 KSPVVSGDTSP S 6 711 NMR LTP unambiguous rat brain 30386294 This site was described as 'S400' in the original paper.
10006195 HLSNVSSTGSI S 6 723 NMR LTP unambiguous rat brain 30386294 This site was descriebed as 'S412' in the original paper.
10006196 LSNVSSTGSID S 6 724 NMR LTP unambiguous rat brain 30386294 This site was described as 'S413' in the original paper.