| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein |
|---|---|---|---|---|
| 475 | HLSNVSSTGSIDMVDSPQLATLADEVSASLAK | S | 3 | 409 |
| 476 | HLSNVSSTGSIDMVDSPQLATLADEVSASLAK | S | 6 | 412 |
| 477 | HLSNVSSTGSIDMVDSPQLATLADEVSASLAK | S | 7 | 413 |
| 10006192 | KTPPGSGEPPK | S | 6 | 496 |
| 10006193 | GEPPKSGERSG | S | 6 | 502 |
| 10006194 | KSPVVSGDTSP | S | 6 | 711 |
| 10006195 | HLSNVSSTGSI | S | 6 | 723 |
| 10006196 | LSNVSSTGSID | S | 6 | 724 |
| ID | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Condition | log2Ratio | P Value | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|
| 475 | MS | LTP | ambiguous | rat | brain | 20706749 | This position assignment in the protein sequence seems problematic, which has not been curated | |||
| 476 | MS | LTP | ambiguous | rat | brain | 20706749 | ||||
| 477 | MS | LTP | ambiguous | rat | brain | 20706749 | This position assignment in the protein sequence seems problematic, which has not been curated | |||
| 10006192 | NMR | LTP | unambiguous | rat | brain | 30386294 | The sequence was "KTPPSSGEPPK" and the site was described as 'S185' in the original paper | |||
| 10006193 | NMR | LTP | unambiguous | rat | brain | 30386294 | This site was described as 'S191' in the original paper. | |||
| 10006194 | NMR | LTP | unambiguous | rat | brain | 30386294 | This site was described as 'S400' in the original paper. | |||
| 10006195 | NMR | LTP | unambiguous | rat | brain | 30386294 | This site was descriebed as 'S412' in the original paper. | |||
| 10006196 | NMR | LTP | unambiguous | rat | brain | 30386294 | This site was described as 'S413' in the original paper. |
| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 475 | HLSNVSSTGSIDMVDSPQLATLADEVSASLAK | S | 3 | 409 | MS | LTP | ambiguous | rat | brain | 20706749 | This position assignment in the protein sequence seems problematic, which has not been curated |
| 476 | HLSNVSSTGSIDMVDSPQLATLADEVSASLAK | S | 6 | 412 | MS | LTP | ambiguous | rat | brain | 20706749 | |
| 477 | HLSNVSSTGSIDMVDSPQLATLADEVSASLAK | S | 7 | 413 | MS | LTP | ambiguous | rat | brain | 20706749 | This position assignment in the protein sequence seems problematic, which has not been curated |
| 10006192 | KTPPGSGEPPK | S | 6 | 496 | NMR | LTP | unambiguous | rat | brain | 30386294 | The sequence was "KTPPSSGEPPK" and the site was described as 'S185' in the original paper |
| 10006193 | GEPPKSGERSG | S | 6 | 502 | NMR | LTP | unambiguous | rat | brain | 30386294 | This site was described as 'S191' in the original paper. |
| 10006194 | KSPVVSGDTSP | S | 6 | 711 | NMR | LTP | unambiguous | rat | brain | 30386294 | This site was described as 'S400' in the original paper. |
| 10006195 | HLSNVSSTGSI | S | 6 | 723 | NMR | LTP | unambiguous | rat | brain | 30386294 | This site was descriebed as 'S412' in the original paper. |
| 10006196 | LSNVSSTGSID | S | 6 | 724 | NMR | LTP | unambiguous | rat | brain | 30386294 | This site was described as 'S413' in the original paper. |