ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein |
---|---|---|---|---|
1214 | VVANGTGTQGQLK | T | 8 | 276 |
10002147 | 274 | |||
10011136 | EVRLLDAENKVVANGTGTQGQLKVPGVSLWW | T | 274 | |
10026577 | VVANGTGTQGQLK | T | 6 | 274 |
ID | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Condition | log2Ratio | P Value | Data Source PMID | Comments |
---|---|---|---|---|---|---|---|---|---|---|
1214 | MS | HTP | ambiguous | human | LNCaP cells | 22661428 | ||||
10002147 | MS | HTP | unambiguous | human | HeLa cells | Interphase/Mitosis | -100 | 34161081 | The p value was -log10p in original paper. | |
10011136 | MS | HTP | unambiguous | human | HeLa cells | 30059200 | ||||
10026577 | MS | HTP | unambiguous | human | HeLa cells | 35254053 |
ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Data Source PMID | Comments |
---|---|---|---|---|---|---|---|---|---|---|---|
1214 | VVANGTGTQGQLK | T | 8 | 276 | MS | HTP | ambiguous | human | LNCaP cells | 22661428 | |
10002147 | 274 | MS | HTP | unambiguous | human | HeLa cells | 34161081 | The p value was -log10p in original paper. | |||
10011136 | EVRLLDAENKVVANGTGTQGQLKVPGVSLWW | T | 274 | MS | HTP | unambiguous | human | HeLa cells | 30059200 | ||
10026577 | VVANGTGTQGQLK | T | 6 | 274 | MS | HTP | unambiguous | human | HeLa cells | 35254053 |