| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein |
|---|---|---|---|---|
| 1943 | EGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIR | S | 35 | 421 |
| 1944 | EGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIR | T | 38 | 424 |
| 1945 | NGNITLLPVNSVSAATL | T | 5 | 265 |
| 1946 | NGNITLLPVNSVSAATL | S | 11 | 271 |
| 1947 | NGNITLLPVNSVSAATL | T | 16 | 276 |
| 1948 | QAVPNSGPIIIRTPTVGPNGQVSW | T | 13 | 453 |
| 1949 | QAVPNSGPIIIRTPTVGPNGQVSW | T | 15 | 455 |
| 1950 | QIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQY | S | 19 | 126 |
| 1951 | QIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQY | T | 21 | 128 |
| 1952 | QIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQY | S | 27 | 134 |
| 1953 | TPIASAASIPAGTVTVNAAQL | S | 8 | 510 |
| 1954 | TPIASAASIPAGTVTVNAAQL | T | 15 | 517 |
| 1955 | VSSQASSSSFF | S | 2 | 312 |
| 1956 | VTNVPVALNGNITLLPVNSVSAATL | T | 2 | 254 |
| 10010247 | QIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQY | S | 13 | 120 |
| 10010248 | QAVPNSGPIIIRTPTVGPNGQVSW | S | 6 | 446 |
| 10010544 | QAGQQKEGEQNQQTQQQQIL | T | 14 | 394 |
| 10010565 | TPIASAASIPAGTVTVNAAQL | S | 5 | 507 |
| 10010593 | NGNITLLPVNSVSAATL | S | 13 | 273 |
| 10019321 | MQGVSLGQTSSSNTTL | S | 5 | 484 |
| 10019322 | S | 491 | ||
| 10019323 | DSEGRGSGDPGK | S | 2 | 612 |
| 10019324 | TSHLRAHLR | T | 1 | 640 |
| 10019325 | TSHLRAHLR | S | 2 | 641 |
| 10019326 | SDHLSKHIK | S | 1 | 698 |
| 10019327 | SDHLSKHIK | S | 5 | 702 |
| 10020030 | MQGVSLGQTSSSNTTL | S | 5 | 484 |
| 10024200 | S | 491 | ||
| 10024201 | S | 612 | ||
| 10024202 | T | 640 | ||
| 10024203 | S | 641 | ||
| 10024204 | S | 698 | ||
| 10024205 | S | 702 |
| ID | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Condition | log2Ratio | P Value | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|
| 1943 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1944 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1945 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1946 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1947 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1948 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1949 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1950 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1951 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1952 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1953 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1954 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1955 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1956 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 10010247 | MS | HTP | unambiguous | human | T cells | None | 29351928 | |||
| 10010248 | MS | HTP | unambiguous | human | T cells | None | 29351928 | |||
| 10010544 | MS | HTP | unambiguous | human | T cells | None | 29351928 | |||
| 10010565 | MS | HTP | unambiguous | human | T cells | None | 29351928 | |||
| 10010593 | MS | HTP | unambiguous | human | T cells | None | 29351928 | |||
| 10019321 | MS, Site-directed mutagenesis | LTP | unambiguous | human | HeLa cells | None | 9343410 | |||
| 10019322 | Site-directed mutagenesis | LTP | unambiguous | human | HEK293T | None | 25484640 | No mass spec. data provided | ||
| 10019323 | Site-directed mutagenesis | LTP | unambiguous | human | HEK293T | None | 25484640 | No mass spec. data provided; the peptide sequence is inferred from tryptic cleavage | ||
| 10019324 | Site-directed mutagenesis | LTP | unambiguous | human | HEK293T | None | 25484640 | No mass spec. data provided; the peptide sequence is inferred from tryptic cleavage | ||
| 10019325 | Site-directed mutagenesis | LTP | unambiguous | human | HEK293T | None | 25484640 | No mass spec. data provided; the peptide sequence is inferred from tryptic cleavage | ||
| 10019326 | Site-directed mutagenesis | LTP | unambiguous | human | HEK293T | None | 25484640 | No mass spec. data provided; the peptide sequence is inferred from tryptic cleavage | ||
| 10019327 | Site-directed mutagenesis | LTP | unambiguous | human | HEK293T | None | 25484640 | No mass spec. data provided; the peptide sequence is inferred from tryptic cleavage | ||
| 10020030 | MS, Site-directed mutagenesis | LTP | unambiguous | human | HeLa cells | None | 11371615 | |||
| 10024200 | site-directed mutagenesis | LTP | unambiguous | human | HEC-1A cells | None | 35499042 | |||
| 10024201 | site-directed mutagenesis | LTP | unambiguous | human | HEC-1A cells | None | 35499042 | |||
| 10024202 | site-directed mutagenesis | LTP | unambiguous | human | HEC-1A cells | None | 35499042 | |||
| 10024203 | site-directed mutagenesis | LTP | unambiguous | human | HEC-1A cells | None | 35499042 | |||
| 10024204 | site-directed mutagenesis | LTP | unambiguous | human | HEC-1A cells | None | 35499042 | |||
| 10024205 | site-directed mutagenesis | LTP | unambiguous | human | HEC-1A cells | None | 35499042 |
| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 1943 | EGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIR | S | 35 | 421 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1944 | EGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIR | T | 38 | 424 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1945 | NGNITLLPVNSVSAATL | T | 5 | 265 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1946 | NGNITLLPVNSVSAATL | S | 11 | 271 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1947 | NGNITLLPVNSVSAATL | T | 16 | 276 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1948 | QAVPNSGPIIIRTPTVGPNGQVSW | T | 13 | 453 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1949 | QAVPNSGPIIIRTPTVGPNGQVSW | T | 15 | 455 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1950 | QIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQY | S | 19 | 126 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1951 | QIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQY | T | 21 | 128 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1952 | QIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQY | S | 27 | 134 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1953 | TPIASAASIPAGTVTVNAAQL | S | 8 | 510 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1954 | TPIASAASIPAGTVTVNAAQL | T | 15 | 517 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1955 | VSSQASSSSFF | S | 2 | 312 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1956 | VTNVPVALNGNITLLPVNSVSAATL | T | 2 | 254 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 10010247 | QIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQY | S | 13 | 120 | MS | HTP | unambiguous | human | T cells | 29351928 | |
| 10010248 | QAVPNSGPIIIRTPTVGPNGQVSW | S | 6 | 446 | MS | HTP | unambiguous | human | T cells | 29351928 | |
| 10010544 | QAGQQKEGEQNQQTQQQQIL | T | 14 | 394 | MS | HTP | unambiguous | human | T cells | 29351928 | |
| 10010565 | TPIASAASIPAGTVTVNAAQL | S | 5 | 507 | MS | HTP | unambiguous | human | T cells | 29351928 | |
| 10010593 | NGNITLLPVNSVSAATL | S | 13 | 273 | MS | HTP | unambiguous | human | T cells | 29351928 | |
| 10019321 | MQGVSLGQTSSSNTTL | S | 5 | 484 | MS, Site-directed mutagenesis | LTP | unambiguous | human | HeLa cells | 9343410 | |
| 10019322 | S | 491 | Site-directed mutagenesis | LTP | unambiguous | human | HEK293T | 25484640 | No mass spec. data provided | ||
| 10019323 | DSEGRGSGDPGK | S | 2 | 612 | Site-directed mutagenesis | LTP | unambiguous | human | HEK293T | 25484640 | No mass spec. data provided; the peptide sequence is inferred from tryptic cleavage |
| 10019324 | TSHLRAHLR | T | 1 | 640 | Site-directed mutagenesis | LTP | unambiguous | human | HEK293T | 25484640 | No mass spec. data provided; the peptide sequence is inferred from tryptic cleavage |
| 10019325 | TSHLRAHLR | S | 2 | 641 | Site-directed mutagenesis | LTP | unambiguous | human | HEK293T | 25484640 | No mass spec. data provided; the peptide sequence is inferred from tryptic cleavage |
| 10019326 | SDHLSKHIK | S | 1 | 698 | Site-directed mutagenesis | LTP | unambiguous | human | HEK293T | 25484640 | No mass spec. data provided; the peptide sequence is inferred from tryptic cleavage |
| 10019327 | SDHLSKHIK | S | 5 | 702 | Site-directed mutagenesis | LTP | unambiguous | human | HEK293T | 25484640 | No mass spec. data provided; the peptide sequence is inferred from tryptic cleavage |
| 10020030 | MQGVSLGQTSSSNTTL | S | 5 | 484 | MS, Site-directed mutagenesis | LTP | unambiguous | human | HeLa cells | 11371615 | |
| 10024200 | S | 491 | site-directed mutagenesis | LTP | unambiguous | human | HEC-1A cells | 35499042 | |||
| 10024201 | S | 612 | site-directed mutagenesis | LTP | unambiguous | human | HEC-1A cells | 35499042 | |||
| 10024202 | T | 640 | site-directed mutagenesis | LTP | unambiguous | human | HEC-1A cells | 35499042 | |||
| 10024203 | S | 641 | site-directed mutagenesis | LTP | unambiguous | human | HEC-1A cells | 35499042 | |||
| 10024204 | S | 698 | site-directed mutagenesis | LTP | unambiguous | human | HEC-1A cells | 35499042 | |||
| 10024205 | S | 702 | site-directed mutagenesis | LTP | unambiguous | human | HEC-1A cells | 35499042 |