Details for Accession #: P07711


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
1199 YSVANDTGFVDIPK T 7 223
10001786 218
10011134 PYEATEESCKYNPKYSVANDTGFVDIPKQEK S 218
10021508 223
10022579 YSVANDTGFVDIPK S 3 218
10025873 YSVANDTGFVDIPK S 2 218
10027965 YSVANDTGFVDIPK S 2 218

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
1199 MS HTP ambiguous human HepG2 cells None 22661428
10001786 MS HTP unambiguous human HeLa cells Interphase/Mitosis None 34161081 The p value was -log10p in original paper.
10011134 MS HTP unambiguous human HeLa cells None 30059200
10021508 MS HTP unambiguous human HeLa cells None 34161081
10022579 MS HTP unambiguous human HeLa cells None 34846842
10025873 MS HTP unambiguous human HeLa cells None 35254053
10027965 MS HTP unambiguous human SW480 cells None 35254053

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
1199 YSVANDTGFVDIPK T 7 223 MS HTP ambiguous human HepG2 cells 22661428
10001786 218 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10011134 PYEATEESCKYNPKYSVANDTGFVDIPKQEK S 218 MS HTP unambiguous human HeLa cells 30059200
10021508 223 MS HTP unambiguous human HeLa cells 34161081
10022579 YSVANDTGFVDIPK S 3 218 MS HTP unambiguous human HeLa cells 34846842
10025873 YSVANDTGFVDIPK S 2 218 MS HTP unambiguous human HeLa cells 35254053
10027965 YSVANDTGFVDIPK S 2 218 MS HTP unambiguous human SW480 cells 35254053