Details for Accession #: P04062


Protein Sequence










Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
10001629 310
10002038 306
10011121 QRDFIARDLGPTLANSTHHNVRLLMLDDQRL S 310
10026113 DLGPTLANSTHHNVR S 9 310
10027261 TYTYADTPDDFQLHNFSLPEEDTK S 17 187
10027958 DLGPTLANSTHHNVR S 9 310

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Condition log2Ratio P Value Data Source PMID Comments
10001629 MS HTP unambiguous human HeLa cells Interphase/Mitosis 100 34161081 The p value was -log10p in original paper.
10002038 MS HTP unambiguous human HeLa cells Interphase/Mitosis -100 34161081 The p value was -log10p in original paper.
10011121 MS HTP unambiguous human HeLa cells 30059200
10026113 MS HTP unambiguous human HeLa cells 35254053
10027261 MS HTP unambiguous human HeLa cells 35254053
10027958 MS HTP unambiguous human SW480 cells 35254053

ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10001629 310 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10002038 306 MS HTP unambiguous human HeLa cells 34161081 The p value was -log10p in original paper.
10011121 QRDFIARDLGPTLANSTHHNVRLLMLDDQRL S 310 MS HTP unambiguous human HeLa cells 30059200
10026113 DLGPTLANSTHHNVR S 9 310 MS HTP unambiguous human HeLa cells 35254053
10027261 TYTYADTPDDFQLHNFSLPEEDTK S 17 187 MS HTP unambiguous human HeLa cells 35254053
10027958 DLGPTLANSTHHNVR S 9 310 MS HTP unambiguous human SW480 cells 35254053