Details for Accession #: P02511

Protein Sequence

>sp|P02511|CRYAB_HUMAN Alpha-crystallin B chain OS=Homo sapiens OX=9606 GN=CRYAB PE=1 SV=2
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSW
FDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR
KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

Peptide Information

ID Peptide Seq Site Residue Position in Peptide Position in Protein
10000401 PAVTAAPKK T 4 170
10003717 EEKPAVTAAPK T 7 170
10010762 EEKPAVTAAPK T 7 170
10016346 EEKPAVTAAPK T 7 170
10020050 162
10021190 162
10021343 162
10027126 EEKPAVTAAPK T 7 170

O-GlcNAcylation Information

ID Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10000401 prediction and site-directed mutagenesis LTP None human U-118 MG cells 26620801 None
10003717 MS HTP None human brain 28657654 None
10010762 MS HTP None human HeLa cells 31492838 None
10016346 MS HTP None human brain 28657654 None
10020050 MS HTP None human HeLa cells 34161081 None
10021190 MS HTP None human HeLa cells 34161081 None
10021343 MS HTP None human HeLa cells 34161081 None
10027126 MS HTP None human HeLa cells 35254053 None
ID Peptide Seq Site Residue Position in Peptide Position in Protein Method Analytical Throughput Ambiguity Species Sample Type Data Source PMID Comments
10000401 PAVTAAPKK T 4 170 prediction and site-directed mutagenesis LTP None human U-118 MG cells 26620801 None
10003717 EEKPAVTAAPK T 7 170 MS HTP None human brain 28657654 None
10010762 EEKPAVTAAPK T 7 170 MS HTP None human HeLa cells 31492838 None
10016346 EEKPAVTAAPK T 7 170 MS HTP None human brain 28657654 None
10020050 162 MS HTP None human HeLa cells 34161081 None
10021190 162 MS HTP None human HeLa cells 34161081 None
10021343 162 MS HTP None human HeLa cells 34161081 None
10027126 EEKPAVTAAPK T 7 170 MS HTP None human HeLa cells 35254053 None