| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein |
|---|---|---|---|---|
| 1212 | VNETEMDIAK | T | 4 | 162 |
| 10002115 | 162 | |||
| 10011105 | CVHIMLSGTVTKVNETEMDIAKHSLFIRHPE | T | 162 | |
| 10029591 | VNETEMDIAK | T | 4 | 162 |
| ID | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Condition | log2Ratio | P Value | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|
| 1212 | MS | HTP | ambiguous | human | LNCaP cells | 22661428 | ||||
| 10002115 | MS | HTP | unambiguous | human | HeLa cells | Interphase/Mitosis | -100 | 34161081 | The p value was -log10p in original paper. | |
| 10011105 | MS | HTP | unambiguous | human | HeLa cells | 30059200 | ||||
| 10029591 | MS | HTP | unambiguous | human | SW620 cells | 35254053 |
| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 1212 | VNETEMDIAK | T | 4 | 162 | MS | HTP | ambiguous | human | LNCaP cells | 22661428 | |
| 10002115 | 162 | MS | HTP | unambiguous | human | HeLa cells | 34161081 | The p value was -log10p in original paper. | |||
| 10011105 | CVHIMLSGTVTKVNETEMDIAKHSLFIRHPE | T | 162 | MS | HTP | unambiguous | human | HeLa cells | 30059200 | ||
| 10029591 | VNETEMDIAK | T | 4 | 162 | MS | HTP | unambiguous | human | SW620 cells | 35254053 |