| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein |
|---|---|---|---|---|
| 1483 | ASATSAVAPITSASPSTDSASKPAFGF | S | 5 | 816 |
| 1484 | ASATSAVAPITSASPSTDSASKPAFGF | T | 11 | 822 |
| 1485 | GAGQSGSTATSTPF | T | 12 | 726 |
| 1486 | GAPASSQPAFGGSTAVF | S | 5 | 1052 |
| 1487 | GAPASSQPAFGGSTAVF | S | 6 | 637 |
| 1488 | GAPASSQPAFGGSTAVF | S | 6 | 1053 |
| 1489 | GAPASSQPAFGGSTAVF | S | 13 | 1060 |
| 1490 | GAPASSQPAFGGSTAVF | T | 14 | 1061 |
| 1491 | GLIPAPSMVPATDTKAPPTL | S | 7 | 669 |
| 1492 | GLIPAPSMVPATDTKAPPTL | T | 19 | 681 |
| 1493 | LFGAPQASAASF | S | 8 | 870 |
| 1494 | LFGAPQASAASF | S | 11 | 873 |
| 1495 | SQSLPTAVPTATSSSAADF | T | 12 | 495 |
| 1496 | SQSLPTAVPTATSSSAADF | S | 13 | 496 |
| 10002977 | 277 | |||
| 10003220 | 322 | |||
| 10003221 | 738 | |||
| 10003222 | 715 | |||
| 10010428 | GSSAKSPLPSYPGANPQPAF | S | 6 | 542 |
| 10020901 | 715 | |||
| 10020902 | 322 | |||
| 10021100 | 699 | |||
| 10021101 | 306 | |||
| 10021441 | 420 | |||
| 10021442 | 27 | |||
| 10021443 | 443 | |||
| 10021455 | 692 | |||
| 10021456 | 299 | |||
| 10023343 | SDAASNSVTETPPITQPSFTFTLPAAAPASPPTSLLAPSTNPLLESLK | T | 11 | 149 |
| 10028894 | APPTLQAETTTKPQATSAPSPAPK | T | 16 | 277 |
| 10028895 | APPTLQAETTTKPQATSAPSPAPK | S | 20 | 281 |
| 10029565 | APPTLQAETTTKPQATSAPSPAPK | T | 11 | 272 |
| 10029566 | APPTLQAETTTKPQATSAPSPAPK | S | 17 | 278 |
| 10030069 | S | 322 | ||
| 10030137 | T | 277 | ||
| 10031548 | QSFLFGTQNTSPSSPAAPAASSASPMFK | S | 2 | 287 |
| 10031549 | QSFLFGTQNTSPSSPAAPAASSASPMFK | S | 21 | 306 |
| 10031550 | QSFLFGTQNTSPSSPAAPAASSASPMFK | S | 24 | 309 |
| 10032251 | PIFTAPPKSEK | S | 322 | |
| 10032253 | QSFLFGTQNTSPSSPAAPAASSASPMFKPIFTAPPK | S | 306 | |
| 10037372 | APPTLQAETTTK | 265 |
| ID | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Condition | log2Ratio | P Value | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|
| 1483 | MS | HTP | ambiguous | human | T cells | None | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated | ||
| 1484 | MS | HTP | ambiguous | human | T cells | None | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated | ||
| 1485 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1486 | MS | HTP | ambiguous | human | T cells | None | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated | ||
| 1487 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1488 | MS | HTP | ambiguous | human | T cells | None | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated | ||
| 1489 | MS | HTP | ambiguous | human | T cells | None | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated | ||
| 1490 | MS | HTP | ambiguous | human | T cells | None | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated | ||
| 1491 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1492 | MS | HTP | ambiguous | human | T cells | None | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated | ||
| 1493 | MS | HTP | ambiguous | human | T cells | None | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated | ||
| 1494 | MS | HTP | ambiguous | human | T cells | None | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated | ||
| 1495 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 1496 | MS | HTP | ambiguous | human | T cells | None | 29351928 | |||
| 10002977 | MS | HTP | unambiguous | human | colorectal cancer (CRC) cell lines | SW620 cells/SW480 cells | None | 6.49E-05 | 35254053 | |
| 10003220 | MS | HTP | unambiguous | human | colorectal cancer (CRC) cell lines | SW620 cells/SW480 cells | None | 0.0107554 | 35254053 | |
| 10003221 | MS | HTP | unambiguous | human | colorectal cancer (CRC) cell lines | SW620 cells/SW480 cells | None | 0.0107554 | 35254053 | |
| 10003222 | MS | HTP | unambiguous | human | colorectal cancer (CRC) cell lines | SW620 cells/SW480 cells | None | 0.0107554 | 35254053 | |
| 10010428 | MS | HTP | unambiguous | human | T cells | None | 29351928 | This site was described as S958 of the protein sequence in the original paper | ||
| 10020901 | MS | HTP | unambiguous | human | HeLa cells | None | 34161081 | |||
| 10020902 | MS | HTP | unambiguous | human | HeLa cells | None | 34161081 | |||
| 10021100 | MS | HTP | unambiguous | human | HeLa cells | None | 34161081 | |||
| 10021101 | MS | HTP | unambiguous | human | HeLa cells | None | 34161081 | |||
| 10021441 | MS | HTP | unambiguous | human | HeLa cells | None | 34161081 | |||
| 10021442 | MS | HTP | unambiguous | human | HeLa cells | None | 34161081 | |||
| 10021443 | MS | HTP | unambiguous | human | HeLa cells | None | 34161081 | |||
| 10021455 | MS | HTP | unambiguous | human | HeLa cells | None | 34161081 | |||
| 10021456 | MS | HTP | unambiguous | human | HeLa cells | None | 34161081 | |||
| 10023343 | MS | HTP | unambiguous | human | THP1 cells | None | 32938750 | |||
| 10028894 | MS | HTP | unambiguous | human | SW620 cells | None | 35254053 | |||
| 10028895 | MS | HTP | unambiguous | human | SW620 cells | None | 35254053 | |||
| 10029565 | MS | HTP | unambiguous | human | SW620 cells | None | 35254053 | |||
| 10029566 | MS | HTP | unambiguous | human | SW620 cells | None | 35254053 | |||
| 10030069 | MS | HTP | unambiguous | human | SW480 cells, SW620 cells | SW620/SW480 | None | 0.0107554 | 35254053 | |
| 10030137 | MS | HTP | unambiguous | human | SW480 cells, SW620 cells | SW620/SW480 | None | 6.49E-05 | 35254053 | |
| 10031548 | MS | HTP | unambiguous | human | HeLa cell nucleus | None | 35289036 | |||
| 10031549 | MS | HTP | unambiguous | human | HeLa cell nucleus | None | 35289036 | |||
| 10031550 | MS | HTP | unambiguous | human | HeLa cell nucleus | None | 35289036 | |||
| 10032251 | MS | HTP | unambiguous | human | MCF-7 cells | None | 35513511 | |||
| 10032253 | MS | HTP | unambiguous | human | MCF-7 cells | None | 35513511 | |||
| 10037372 | MS | HTP | unambiguous | human | HEK 293T cells | TMG/control | None | 30620550 | Peptide quantification value was applied to each modification site |
| ID | Peptide Seq | Site Residue | Position in Peptide | Position in Protein | Method | Analytical Throughput | Ambiguity | Species | Sample Type | Data Source PMID | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 1483 | ASATSAVAPITSASPSTDSASKPAFGF | S | 5 | 816 | MS | HTP | ambiguous | human | T cells | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated |
| 1484 | ASATSAVAPITSASPSTDSASKPAFGF | T | 11 | 822 | MS | HTP | ambiguous | human | T cells | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated |
| 1485 | GAGQSGSTATSTPF | T | 12 | 726 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1486 | GAPASSQPAFGGSTAVF | S | 5 | 1052 | MS | HTP | ambiguous | human | T cells | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated |
| 1487 | GAPASSQPAFGGSTAVF | S | 6 | 637 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1488 | GAPASSQPAFGGSTAVF | S | 6 | 1053 | MS | HTP | ambiguous | human | T cells | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated |
| 1489 | GAPASSQPAFGGSTAVF | S | 13 | 1060 | MS | HTP | ambiguous | human | T cells | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated |
| 1490 | GAPASSQPAFGGSTAVF | T | 14 | 1061 | MS | HTP | ambiguous | human | T cells | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated |
| 1491 | GLIPAPSMVPATDTKAPPTL | S | 7 | 669 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1492 | GLIPAPSMVPATDTKAPPTL | T | 19 | 681 | MS | HTP | ambiguous | human | T cells | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated |
| 1493 | LFGAPQASAASF | S | 8 | 870 | MS | HTP | ambiguous | human | T cells | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated |
| 1494 | LFGAPQASAASF | S | 11 | 873 | MS | HTP | ambiguous | human | T cells | 29351928 | This position assignment in the protein sequence seems problematic, which has not been curated |
| 1495 | SQSLPTAVPTATSSSAADF | T | 12 | 495 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 1496 | SQSLPTAVPTATSSSAADF | S | 13 | 496 | MS | HTP | ambiguous | human | T cells | 29351928 | |
| 10002977 | 277 | MS | HTP | unambiguous | human | colorectal cancer (CRC) cell lines | 35254053 | ||||
| 10003220 | 322 | MS | HTP | unambiguous | human | colorectal cancer (CRC) cell lines | 35254053 | ||||
| 10003221 | 738 | MS | HTP | unambiguous | human | colorectal cancer (CRC) cell lines | 35254053 | ||||
| 10003222 | 715 | MS | HTP | unambiguous | human | colorectal cancer (CRC) cell lines | 35254053 | ||||
| 10010428 | GSSAKSPLPSYPGANPQPAF | S | 6 | 542 | MS | HTP | unambiguous | human | T cells | 29351928 | This site was described as S958 of the protein sequence in the original paper |
| 10020901 | 715 | MS | HTP | unambiguous | human | HeLa cells | 34161081 | ||||
| 10020902 | 322 | MS | HTP | unambiguous | human | HeLa cells | 34161081 | ||||
| 10021100 | 699 | MS | HTP | unambiguous | human | HeLa cells | 34161081 | ||||
| 10021101 | 306 | MS | HTP | unambiguous | human | HeLa cells | 34161081 | ||||
| 10021441 | 420 | MS | HTP | unambiguous | human | HeLa cells | 34161081 | ||||
| 10021442 | 27 | MS | HTP | unambiguous | human | HeLa cells | 34161081 | ||||
| 10021443 | 443 | MS | HTP | unambiguous | human | HeLa cells | 34161081 | ||||
| 10021455 | 692 | MS | HTP | unambiguous | human | HeLa cells | 34161081 | ||||
| 10021456 | 299 | MS | HTP | unambiguous | human | HeLa cells | 34161081 | ||||
| 10023343 | SDAASNSVTETPPITQPSFTFTLPAAAPASPPTSLLAPSTNPLLESLK | T | 11 | 149 | MS | HTP | unambiguous | human | THP1 cells | 32938750 | |
| 10028894 | APPTLQAETTTKPQATSAPSPAPK | T | 16 | 277 | MS | HTP | unambiguous | human | SW620 cells | 35254053 | |
| 10028895 | APPTLQAETTTKPQATSAPSPAPK | S | 20 | 281 | MS | HTP | unambiguous | human | SW620 cells | 35254053 | |
| 10029565 | APPTLQAETTTKPQATSAPSPAPK | T | 11 | 272 | MS | HTP | unambiguous | human | SW620 cells | 35254053 | |
| 10029566 | APPTLQAETTTKPQATSAPSPAPK | S | 17 | 278 | MS | HTP | unambiguous | human | SW620 cells | 35254053 | |
| 10030069 | S | 322 | MS | HTP | unambiguous | human | SW480 cells, SW620 cells | 35254053 | |||
| 10030137 | T | 277 | MS | HTP | unambiguous | human | SW480 cells, SW620 cells | 35254053 | |||
| 10031548 | QSFLFGTQNTSPSSPAAPAASSASPMFK | S | 2 | 287 | MS | HTP | unambiguous | human | HeLa cell nucleus | 35289036 | |
| 10031549 | QSFLFGTQNTSPSSPAAPAASSASPMFK | S | 21 | 306 | MS | HTP | unambiguous | human | HeLa cell nucleus | 35289036 | |
| 10031550 | QSFLFGTQNTSPSSPAAPAASSASPMFK | S | 24 | 309 | MS | HTP | unambiguous | human | HeLa cell nucleus | 35289036 | |
| 10032251 | PIFTAPPKSEK | S | 322 | MS | HTP | unambiguous | human | MCF-7 cells | 35513511 | ||
| 10032253 | QSFLFGTQNTSPSSPAAPAASSASPMFKPIFTAPPK | S | 306 | MS | HTP | unambiguous | human | MCF-7 cells | 35513511 | ||
| 10037372 | APPTLQAETTTK | 265 | MS | HTP | unambiguous | human | HEK 293T cells | 30620550 | Peptide quantification value was applied to each modification site |